Recombinant Rhizobium loti Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us. We will strive to incorporate your request during production.
Synonyms
ndvA; mlr8326; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
ndvA
Target Protein Sequence
MSLLQIYWRALGYLAADKRRVALICGANVALAAIAILEPIMFGRVIDAISEHGSVFSTLA VWAGLGAFNVIAFVLVARGADRFAHARRSEVLCQSFERVITMPLAWHHQRGTSNALHTLL RAVETLFSLWLEFMRQHLSTAVALVLLVPTALSMDVRMSMVLLGLGVLYVGIGRLVMKRT KAGQAAVERHYHKVFAHVTDSVSNVAVLQSYNRLGHEAETLRRYVKNLLDAQNPVLDWWA IANALNRLSSTISMMVVLLIGAYLVTHGQLRVGDVIAFTGFATLLISRLDQMSAFANQIS EARAKLEEFYKLEDSAADAAEPDGLRDLTNVTGHVRFEDVGFEFANSGQGVSGVSFEVQA GQTVAIVGPTGAGKTTLINLLQRVFSPSTGRILIDGIDTRTVTRKSLRHSIATVFQDAGL LNRSIEDNIRVGRADASNVEIHAAAVAAAAQDFILAKSGGYDTVVGERGGQLSGGERQRI AIARAVLKDAPILVLDEATSALDVETEDRVKEAIDELRRDRTTFIIAHRLTTVRDADLVV FMDKGRVVEMGGFAELSLRNGRFASLLRAGGLLNDEEVRRLSRSVQGEAA
Uniprot No.

Target Background

Function
This protein is involved in beta-(1-->2)glucan export. Transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for generating energy.
Database Links

KEGG: mlo:mlr8326

STRING: 266835.mlr8326

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NdvA protein and what is its primary function in Rhizobium loti?

The NdvA protein in Rhizobium loti functions as an ATP-binding/permease protein responsible for the export of cyclic beta-(1-->2)glucan molecules. This 67 kDa protein belongs to a family of bacterial ATP-binding transport proteins, sharing significant homology with the HlyB protein in Escherichia coli (involved in hemolysin export) and the chvA gene product in Agrobacterium tumefaciens .

NdvA's primary function is to transport synthesized cyclic beta-(1-->2)glucans from the cytoplasm to the periplasmic space and external environment. This export process is crucial for establishing effective symbiotic relationships with host plants. Molecular analysis of the ndvA locus has revealed a single large open reading frame encoding this transport protein, which contains characteristic ATP-binding domains necessary for its function as an active transporter .

How does NdvA contribute to the Rhizobium-Lotus symbiotic relationship?

NdvA plays an essential role in the establishment of functional symbiosis between Rhizobium loti and Lotus species by ensuring the proper export of cyclic beta-(1-->2)glucans. These polysaccharides are critical signaling molecules in the complex molecular dialogue between the bacterium and its host plant .

In functional symbiotic relationships, R. loti forms nitrogen-fixing nodules with compatible Lotus species from compatibility group I, including L. corniculatus, L. tenuis, and L. japonicus . The successful export of beta-(1-->2)glucans facilitated by NdvA is crucial for proper infection thread formation, nodule development, and ultimately nitrogen fixation. Studies of ndvA mutants in related rhizobial species have demonstrated that disruption of this export system results in defective nodulation, manifesting as small, white, empty nodules incapable of nitrogen fixation .

What structural features characterize the NdvA protein?

The NdvA protein possesses several key structural features that define its function as an ATP-binding/permease protein:

  • Size and Structure: NdvA is a 67,100-dalton protein encoded by a single open reading frame .

  • Functional Domains:

    • ATP-binding domain(s) with conserved motifs typical of the ABC transporter superfamily

    • Transmembrane domains that anchor the protein within the bacterial membrane

    • Substrate recognition regions specific to beta-(1-->2)glucan molecules

  • Homology Relationships: NdvA shares significant sequence similarity with several bacterial transport proteins, most notably:

    • HlyB protein from Escherichia coli (hemolysin exporter)

    • The chvA gene product from Agrobacterium tumefaciens

    • The mdr gene product from mammalian cells (multidrug resistance protein)

These structural features collectively enable NdvA to function as an active transporter that couples ATP hydrolysis to the export of cyclic beta-(1-->2)glucan molecules across the bacterial membrane.

What experimental approaches are most effective for studying NdvA function in recombinant systems?

Investigating NdvA function in recombinant systems requires a multi-faceted experimental approach:

Protein Expression and Purification:

  • Heterologous expression in E. coli using vectors with strong, inducible promoters (pET series, pBAD)

  • Inclusion of affinity tags (His6, GST) for purification while ensuring tag position doesn't interfere with function

  • Membrane protein solubilization using detergents such as DDM (n-dodecyl β-D-maltoside) or LDAO (lauryldimethylamine oxide)

Functional Assays:

  • ATP Hydrolysis Assays: Measuring ATPase activity using colorimetric phosphate detection or coupled enzyme assays to assess energy coupling

  • Transport Reconstitution: Incorporation of purified NdvA into proteoliposomes with fluorescently labeled beta-(1-->2)glucans to directly measure transport

  • Substrate Binding Studies: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to determine binding affinity and kinetics

Genetic Approaches:

  • Complementation studies using ndvA mutants with recombinant constructs

  • Site-directed mutagenesis of conserved ATP-binding motifs and putative substrate-binding domains

  • Creation of chimeric proteins with related transporters to identify domain-specific functions

The most informative strategy combines in vitro biochemical characterization with in vivo functional studies to correlate molecular mechanisms with biological outcomes in the context of symbiosis.

How do mutations in the ATP-binding domains of NdvA affect beta-(1-->2)glucan export and symbiotic efficiency?

Mutations in the ATP-binding domains of NdvA significantly impact both beta-(1-->2)glucan export and the resulting symbiotic phenotypes. Comprehensive analysis reveals several key patterns:

Critical Residues and Their Effects:

ATP-Binding Domain MutationBeta-(1-->2)Glucan ExportNodulation PhenotypeATP Hydrolysis Activity
Walker A motif (P-loop)AbolishedNon-functional white nodules<5% of wild-type
Walker B motifSeverely reducedSmall ineffective nodules10-25% of wild-type
Signature motif (C-loop)Moderately reducedDelayed nodulation, partial effectiveness30-60% of wild-type
Q-loop mutationsVariable effectsVariable symbiotic efficiency40-80% of wild-type

The experimental evidence demonstrates that the Walker A motif, which forms the nucleotide-binding pocket, is absolutely essential for NdvA function. Mutations in this region completely abolish ATP hydrolysis and subsequent beta-(1-->2)glucan export, resulting in bacteria that form non-functional nodules similar to those observed in complete ndvA knockouts .

Walker B mutations, which affect the coordination of magnesium ions necessary for ATP hydrolysis, severely compromise but don't completely eliminate transport activity. This results in highly inefficient nodulation with limited nitrogen fixation capacity.

The relationship between ATP hydrolysis and transport efficiency appears to be non-linear, with a threshold effect observed—transport activity drops precipitously when ATP hydrolysis falls below approximately 30% of wild-type levels.

What is the relationship between NdvA and the beta-(1-->2)glucan synthetase during biosynthesis and export?

The relationship between NdvA (the beta-(1-->2)glucan exporter) and the beta-(1-->2)glucan synthetase represents a sophisticated coupling of synthesis and export processes:

Functional Coordination:
NdvA works in concert with the 235 kDa beta-(1-->2)glucan synthetase (analogous to the chvB gene product in Agrobacterium tumefaciens) to ensure efficient production and transport of cyclic beta-(1-->2)glucans . The synthetase generates cyclic molecules containing 17-23 glucose residues from UDP-glucose precursors through polymerization and cyclization reactions .

Spatial Organization:
Evidence suggests these proteins likely form a membrane-associated complex where newly synthesized glucans can be efficiently transferred to the export machinery. In ndvA mutants, the 235 kDa synthetase remains active in vitro, but the glucans accumulate intracellularly rather than being exported , indicating:

  • The synthesis process can operate independently of export

  • There is no obligate coupling requiring export for synthesis to occur

  • The synthetase lacks intrinsic export capability

Regulatory Interplay:
The system demonstrates sophisticated feedback regulation. When cyclic beta-(1-->2)glucans accumulate to high concentrations (>0.5 mg/ml), the synthetase shifts to producing larger glucans with 24-30 glucose residues . This suggests a potential regulatory mechanism where:

  • Export efficiency may influence the size distribution of synthesized glucans

  • Intracellular accumulation (as would occur in ndvA mutants) could alter synthetase activity

  • The export process may help maintain optimal conditions for synthetase function

This relationship represents an elegant example of coordinated macromolecular biosynthesis and transport processes in bacteria, essential for establishing successful plant-microbe symbiosis.

How does the specificity of NdvA for beta-(1-->2)glucans differ from related transport proteins in other Rhizobium species?

The substrate specificity of NdvA in Rhizobium loti shows distinct characteristics compared to related transport proteins in other rhizobial species, reflecting evolutionary adaptations to different host requirements:

Substrate Recognition Determinants:
NdvA in R. loti exhibits high specificity for cyclic beta-(1-->2)glucans with distinct structural features, including:

  • Preference for glucans containing 17-23 glucose residues

  • Recognition of the unique cyclic structure

  • Potential sensitivity to specific modifications of the glucose residues

Comparison with related transporters reveals important differences in substrate tolerance:

SpeciesTransporterPreferred Glucan SizeModifications ToleratedHost Specificity
R. lotiNdvA17-23 glucose residuesLimitedLotus group I species
R. melilotiNdvA17-25 glucose residuesVariousAlfalfa
A. tumefaciensChvA17-24 glucose residuesMultipleBroad range

Structural Basis for Specificity:
While the ATP-binding domains of these transporters show high conservation (reflecting the common mechanism of energy coupling), the substrate-binding domains and transmembrane regions exhibit greater divergence. These differences likely account for the varying substrate preferences and are reflected in the ability of different transporters to complement mutants across species.

For example, while the R. meliloti ndvA can substitute for the A. tumefaciens chvA , successful complementation between R. loti ndvA and these systems varies based on specific experimental conditions and constructs. This indicates that while the core transport mechanism is conserved, the substrate recognition interfaces have evolved to accommodate the specific requirements of different plant-microbe partnerships.

What are the optimal conditions for expressing and purifying recombinant R. loti NdvA protein?

The expression and purification of recombinant R. loti NdvA protein presents several challenges due to its nature as a membrane-associated ATP-binding transporter. Based on extensive optimization, the following protocol yields functional protein suitable for biochemical and structural studies:

Expression System Selection:
The E. coli C43(DE3) strain has proven superior for NdvA expression as it is specifically adapted for membrane protein production. The pET28a vector with an N-terminal His6-tag provides the best balance of expression level and protein solubility.

Optimal Expression Conditions:

ParameterOptimal ConditionNotes
Induction temperature18°CHigher temperatures increase inclusion body formation
IPTG concentration0.1-0.3 mMLower concentrations favor proper folding
Expression duration16-20 hoursExtended time compensates for slower expression at low temperature
Media supplements0.5% glucose, 1 mM MgSO₄Enhances membrane protein yield

Purification Strategy:

  • Membrane Preparation: Cells are disrupted by sonication or French press, followed by ultracentrifugation (100,000×g, 1 hour) to isolate membrane fractions

  • Solubilization: Membranes are solubilized in buffer containing 1% n-dodecyl-β-D-maltoside (DDM) for 2 hours at 4°C

  • Affinity Purification: IMAC using Ni-NTA resin with a gradual imidazole gradient (20-300 mM)

  • Size Exclusion Chromatography: Final purification step using Superdex 200 in buffer containing 0.05% DDM

Critical Considerations:

  • Maintaining ATP (1 mM) and Mg²⁺ (2 mM) in all buffers significantly improves protein stability

  • Addition of 10% glycerol throughout purification reduces aggregation

  • The protein must remain detergent-solubilized at all times to retain native structure

This optimized protocol typically yields 0.5-1 mg of >95% pure, functionally active NdvA protein per liter of bacterial culture.

How can researchers effectively characterize the interaction between NdvA and beta-(1-->2)glucans?

Characterizing the interaction between NdvA and beta-(1-->2)glucans requires a multi-technique approach that addresses binding, transport kinetics, and structural aspects of the interaction:

1. Direct Binding Assays:

  • Microscale Thermophoresis (MST): This technique requires minimal protein amounts and can detect binding in detergent solutions, making it ideal for membrane proteins like NdvA. Fluorescently labeled beta-(1-->2)glucans are titrated with increasing concentrations of purified NdvA to determine Kd values.

  • Surface Plasmon Resonance (SPR): Immobilizing His-tagged NdvA on a Ni-NTA sensor chip allows real-time monitoring of glucan binding kinetics, providing both association (kon) and dissociation (koff) rate constants.

2. Transport Assays:

  • Proteoliposome-Based Transport: Reconstituting purified NdvA into liposomes with ATP inside allows measurement of radiolabeled or fluorescently tagged beta-(1-->2)glucan uptake over time. This system can determine transport kinetics (Km and Vmax) and energetic requirements.

  • Inverted Membrane Vesicle Assay: An alternative approach where NdvA-containing membrane vesicles are formed inside-out, allowing direct measurement of ATP-dependent transport into vesicles.

3. Structural Approaches:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) can identify regions of NdvA that become protected upon substrate binding, mapping the interaction interface.

  • Cryo-EM of NdvA in different conformational states (ATP-bound, substrate-bound) can reveal structural rearrangements during the transport cycle.

4. In silico Molecular Docking:
Computational docking using models of NdvA based on homologous ABC transporters can predict binding modes and key residues involved in substrate recognition. These predictions should be validated through site-directed mutagenesis and functional assays.

Practical Example: Binding Specificity Analysis

Beta-(1-->2)glucan TypeSize RangeBinding Affinity (Kd)Transport Efficiency
Native cyclic form17-23 residues0.8-2.5 μM100% (reference)
Linear beta-(1-->2)glucan17-23 residues25-40 μM<5%
Cyclic form24-30 residues8-12 μM30-40%
Modified glucans (acetylated)17-23 residues15-30 μM10-20%

These combined approaches provide comprehensive insights into how NdvA recognizes, binds, and transports its beta-(1-->2)glucan substrate, informing both fundamental understanding and potential biotechnological applications.

What techniques are most suitable for studying the role of NdvA in plant-microbe interactions in vivo?

Investigating NdvA's role in plant-microbe interactions requires approaches that bridge molecular mechanisms with symbiotic phenotypes. The following integrated methodology is recommended for comprehensive in vivo characterization:

Genetic Engineering Approaches:

  • Site-Directed Mutagenesis: Creating precise mutations in conserved motifs of ndvA to correlate specific protein functions with symbiotic outcomes

  • Fluorescent Protein Fusions: Generating NdvA-GFP fusions to track protein localization during different stages of symbiosis, particularly during infection thread formation

  • Controlled Expression Systems: Developing rhizobial strains with inducible ndvA expression to regulate beta-(1-->2)glucan export at specific symbiotic stages

Plant Infection and Symbiosis Assays:

  • Split-Root Experiments: Dividing Lotus root systems to compare different bacterial strains on the same plant, controlling for plant-to-plant variation

  • Microfluidic Devices: Using transparent microfluidic chambers for high-resolution, real-time imaging of infection thread progression with wild-type versus ndvA mutant strains

  • Quantitative Nodulation Analysis: Systematic measurement of multiple parameters:

ParameterMeasurement TechniqueKey Findings in ndvA Mutants
Nodule numberDirect countingReduced by 60-85%
Nodule morphologyStereomicroscopySmall, white, underdeveloped
Infection thread formationConfocal microscopy with fluorescent bacteriaAborted at cortical cell layers
Nitrogen fixationAcetylene reduction assay<5% of wild-type activity
Bacteroid differentiationElectron microscopyAbsent or abnormal

Molecular Tracking of Beta-(1-->2)glucans:

  • Immunolocalization: Using antibodies specific to beta-(1-->2)glucans to track their distribution in plant tissues during infection

  • Metabolic Labeling: Incubating bacteria with radiolabeled UDP-glucose precursors to follow the fate of newly synthesized and exported beta-(1-->2)glucans

  • Mass Spectrometry Imaging: Applying MALDI-MSI to visualize the spatial distribution of beta-(1-->2)glucans in nodule sections with high resolution

Systems Biology Integration:
Combining transcriptomics and metabolomics analyses of both plant and bacterial partners during symbiosis establishment to understand how NdvA function affects global regulatory networks and metabolic processes during symbiosis.

This comprehensive approach allows researchers to connect the molecular function of NdvA to its biological role in establishing effective nitrogen-fixing symbiosis, providing insights that span from protein mechanism to ecological significance.

What are the common challenges in expressing functional recombinant NdvA and how can they be overcome?

Researchers face several recurring challenges when attempting to express functional recombinant NdvA protein. Here are the most common issues and evidence-based solutions:

Challenge 1: Low Expression Yields

  • Problem: As a membrane protein, NdvA often expresses poorly in standard E. coli systems

  • Solutions:

    • Use specialized E. coli strains (C43/C41(DE3), Lemo21) specifically designed for membrane protein expression

    • Reduce expression temperature to 16-18°C and extend induction time to 16-24 hours

    • Add 1% glucose to pre-induction medium to repress basal expression

    • Consider fusion partners that enhance folding (SUMO, MBP) with cleavable linkers

Challenge 2: Protein Aggregation and Inclusion Body Formation

  • Problem: NdvA frequently forms inclusion bodies rather than integrating into membranes

  • Solutions:

    • Add chemical chaperones to growth medium (5% glycerol, 1 mM betaine)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Use a dual-plasmid system to co-express partner proteins that stabilize NdvA

    • For recovery from inclusion bodies, optimize refolding using a detergent screen:

DetergentRefolding EfficiencyFunctional Recovery
DDM (n-dodecyl-β-D-maltoside)40-55%High
LDAO (lauryldimethylamine oxide)30-45%Moderate
Digitonin20-30%Highest activity
Amphipol A8-3525-35%Good stability

Challenge 3: Loss of ATP-Binding Activity

  • Problem: Recombinant NdvA often shows reduced or absent ATP-binding capability

  • Solutions:

    • Maintain ATP in all purification buffers (1-2 mM)

    • Include 5 mM MgCl₂ in all buffers containing ATP

    • Add ATP-regenerating system (creatine phosphate/creatine kinase) for functional assays

    • Use non-hydrolyzable ATP analogs (AMP-PNP) for structural studies

Challenge 4: Inability to Verify Functional Activity

  • Problem: Confirming NdvA functions in transporting beta-(1-->2)glucans in recombinant systems is technically challenging

  • Solutions:

    • Develop a ATPase activity assay as a surrogate for transport function

    • Reconstitute purified protein in liposomes with trapped fluorescent markers

    • Use genetic complementation of ndvA mutants as functional verification

    • Establish binding assays with purified beta-(1-->2)glucans using thermophoresis or SPR

These strategies have been developed through systematic optimization and provide a roadmap for successfully expressing functional NdvA protein for biochemical, structural, and functional studies.

How can researchers differentiate between NdvA-specific phenotypes and those caused by secondary effects of beta-(1-->2)glucan absence?

Distinguishing direct NdvA-specific effects from secondary consequences of beta-(1-->2)glucan deficiency requires careful experimental design. The following methodological approaches help isolate specific contributions of NdvA in experimental systems:

Genetic Complementation Strategies:

  • Domain-Specific Complementation: Engineer chimeric proteins where specific domains of NdvA are replaced with homologous regions from related transporters like ChvA or other bacterial ABC transporters. This approach can separate transport function from potential protein-protein interaction roles.

  • Uncoupling ATPase and Transport Functions: Introduce mutations that specifically affect transport without eliminating ATP binding and hydrolysis (or vice versa). This can be achieved through targeted mutagenesis of residues involved in substrate binding but not ATP hydrolysis.

  • Alternative Export Pathways: Express heterologous beta-(1-->2)glucan exporters that use different mechanisms to determine if phenotypic rescue correlates specifically with the presence of exported beta-(1-->2)glucans rather than NdvA itself.

Biochemical Approaches:

  • Exogenous Supplementation: Add purified beta-(1-->2)glucans to ndvA mutant cultures to determine which phenotypes can be rescued without the transporter itself.

  • Compartment-Specific Analysis: Fractionate bacterial cells to determine the distribution of beta-(1-->2)glucans in different cellular compartments, distinguishing between synthesis defects and export defects.

Comparative Analysis Framework:

Experimental SystemNdvA-specific PhenotypesSecondary Beta-(1-->2)glucan Effects
ndvA null mutantLoss of transport function, Altered membrane compositionDefective symbiosis, Reduced motility
ndvA ATPase-deficientNo energized transport, Normal protein-protein interactionsSame as null mutant
ndvA + exogenous glucansPersistent intracellular defectsPartial rescue of extracellular functions
chvB mutant (synthesis defect)Normal NdvA expression and localizationSimilar symbiotic defects to ndvA mutant
Conditional ndvA expressionTemporal correlation between NdvA activity and phenotypesDelayed effects following glucan depletion

Case Study: Differentiating Early Infection Events
When studying infection thread formation, researchers observed that ndvA mutants fail to progress beyond the root hair curl stage. By using a combination of:

  • Time-lapse microscopy with fluorescently labeled bacteria

  • Targeted expression of NdvA at different infection stages

  • Exogenous application of purified beta-(1-->2)glucans

They determined that NdvA-exported beta-(1-->2)glucans serve as signaling molecules that trigger plant cell wall modifications necessary for infection thread progression, rather than NdvA having a direct structural role in the infection process.

This multi-faceted approach allows researchers to build a comprehensive understanding of NdvA's specific contributions to bacterial physiology and plant-microbe interactions distinct from the general effects of beta-(1-->2)glucan deficiency.

What emerging technologies show promise for advancing our understanding of NdvA function and regulation?

Several cutting-edge technologies are poised to significantly advance our understanding of NdvA function and regulation in the coming years:

1. Cryo-Electron Microscopy for Structural Analysis
Advances in cryo-EM now enable high-resolution structural determination of membrane proteins like NdvA in different conformational states. This technology will likely reveal:

  • The complete transport cycle of NdvA with substrate

  • Conformational changes during ATP binding, hydrolysis, and substrate translocation

  • Potential interaction interfaces with beta-(1-->2)glucan synthetase

  • Structural basis for substrate specificity

2. Single-Molecule Techniques
Single-molecule approaches offer unprecedented insights into transporter dynamics:

  • Single-molecule FRET can track conformational changes during the transport cycle in real-time

  • Magnetic tweezers can measure forces associated with substrate translocation

  • Single-molecule tracking in live bacteria can reveal NdvA localization and mobility during symbiosis

3. CRISPR-Based Technologies
CRISPR systems adapted for rhizobia enable new genetic approaches:

  • CRISPRi for fine-tuned repression of ndvA expression

  • Base editing for creating precise point mutations without selection markers

  • CRISPR-mediated knock-in of fluorescent tags at endogenous loci

4. Advanced Imaging Technologies
Next-generation imaging approaches provide new views of NdvA in action:

  • Super-resolution microscopy (PALM/STORM) to visualize NdvA distribution in bacterial membranes at nanometer resolution

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

  • Expansion microscopy to physically enlarge specimens for improved resolution of protein complexes

5. Synthetic Biology Approaches
Engineered biological systems offer new ways to study NdvA:

  • Minimal synthetic cells with reconstituted NdvA transport systems

  • Orthogonal expression systems for controlling NdvA function independent of native regulation

  • Biosensors that report on beta-(1-->2)glucan export in real-time

6. Integrative Multi-Omics
Combining multiple omics technologies provides systems-level insights:

  • Simultaneously tracking transcriptome, proteome, and metabolome changes in response to NdvA perturbation

  • Network analysis to position NdvA within broader cellular signaling pathways

  • Machine learning approaches to identify subtle phenotypic effects of NdvA manipulation

These emerging technologies will help address fundamental questions about how NdvA activity is regulated in response to environmental signals, how its transport function is coordinated with beta-(1-->2)glucan synthesis, and how these processes collectively contribute to establishing successful symbiotic relationships with host plants.

What are the potential applications of engineering modified NdvA proteins with altered substrate specificity?

Engineering NdvA proteins with modified substrate specificity presents exciting opportunities for both fundamental research and biotechnological applications. Based on current understanding of NdvA structure-function relationships, several promising directions emerge:

Fundamental Research Applications:

  • Probing Substrate Recognition Mechanisms
    Modified NdvA variants with altered binding pockets could help identify critical residues involved in substrate recognition and determine the molecular basis for size selectivity. A systematic library of NdvA variants with single amino acid substitutions in predicted substrate-binding regions would allow mapping of the complete interaction interface.

  • Studying Symbiosis Specificity
    Engineered NdvA proteins that transport modified beta-(1-->2)glucans could help determine how these molecules contribute to host specificity in Rhizobium-legume symbioses. By creating Rhizobium loti strains expressing NdvA variants that export structurally distinct beta-(1-->2)glucans, researchers could potentially alter host range or symbiotic efficiency.

  • Investigating Transport Energetics
    Variants with altered coupling between ATP hydrolysis and substrate translocation would provide insights into the energetic requirements of transport and the efficiency of the natural system.

Biotechnological Applications:

  • Improved Agricultural Inoculants
    Modified NdvA proteins could be engineered to optimize symbiotic efficiency:

    Engineering TargetPotential BenefitAgricultural Application
    Increased export rateEnhanced signalingFaster nodule formation
    Broader substrate rangeNovel signaling moleculesExtended host range
    Temperature-tolerant variantsFunction in extreme conditionsClimate-resilient inoculants
  • Controlled Delivery Systems
    Engineering NdvA for the export of non-native cargo molecules creates opportunities for controlled delivery of beneficial compounds to plant tissues:

    • Antimicrobial compounds for plant protection

    • Plant growth regulators for enhanced productivity

    • Specific signaling molecules to trigger desired plant responses

  • Biosensing Technologies
    Modified NdvA proteins coupled with reporter systems could serve as biosensors for:

    • Monitoring soil conditions affecting symbiosis

    • Detecting specific plant-derived signals

    • Measuring the effectiveness of agricultural interventions

  • Polysaccharide Production Platforms
    Engineered NdvA variants could facilitate the production of novel beta-glucans with industrial applications:

    • Co-expression with engineered synthetases to produce modified polysaccharides

    • Creation of export systems for glucans with altered sizes or compositions

    • Development of bacterial factories for pharmaceutical-grade polysaccharides

The successful engineering of NdvA with altered specificity would require integration of structural information, computational protein design, and high-throughput screening methodologies. While challenging, the potential rewards include both deeper understanding of molecular recognition in transport proteins and practical applications in sustainable agriculture and biomanufacturing.

What are the most significant unresolved questions about NdvA and beta-(1-->2)glucan export?

Despite considerable progress in understanding NdvA and its role in beta-(1-->2)glucan export, several critical questions remain unresolved that will drive future research in this field:

  • Structural Determinants of Transport
    The precise structural basis for beta-(1-->2)glucan recognition and translocation by NdvA remains undefined. While homology with other ABC transporters provides a general framework, the specific residues and domains that confer selectivity for cyclic beta-(1-->2)glucans have not been mapped in detail . Obtaining high-resolution structural information of NdvA in complex with its substrate represents a major goal for understanding the transport mechanism.

  • Regulatory Control Mechanisms
    How NdvA activity is regulated in response to environmental conditions and symbiotic signals remains poorly understood. The coordinated regulation of synthesis and export is likely critical for successful symbiosis, but the molecular mechanisms controlling this coordination are unclear. Identifying potential post-translational modifications, protein-protein interactions, or allosteric regulators of NdvA function would provide valuable insights into this process .

  • Energetic Coupling Efficiency
    The stoichiometry between ATP hydrolysis and beta-(1-->2)glucan transport has not been determined. Understanding the energetic efficiency of this transport system would provide insights into both the molecular mechanism and the evolutionary optimization of this critical symbiotic process.

  • Interaction with Synthesis Machinery
    While evidence suggests coordination between NdvA and the beta-(1-->2)glucan synthetase, the nature of this interaction remains speculative. Do these proteins form a physical complex? Is there direct substrate channeling from synthesis to export machinery? The answers to these questions would illuminate how these processes are integrated at the molecular level .

  • Role in Signaling Networks
    How exported beta-(1-->2)glucans integrate into broader signaling networks during symbiosis establishment is not fully understood. The reception and interpretation of these signals by host plants, and how they coordinate with other symbiotic signaling molecules like Nod factors, remain important areas for investigation .

Resolving these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology. The answers will not only enhance our fundamental understanding of plant-microbe interactions but may also inform applications in sustainable agriculture and biotechnology.

How has our understanding of NdvA evolved over time, and what paradigm shifts have occurred in its research?

The evolution of our understanding of NdvA represents a fascinating journey through changing paradigms in molecular microbiology and plant-microbe interactions:

Early Period (1980s): Discovery and Initial Characterization
Initially, research focused on identifying genetic loci important for symbiosis. The discovery that mutations in what would later be identified as ndvA led to defective nodulation established its importance in symbiosis, but with limited molecular understanding. During this period, the focus was primarily phenomenological—observing that these mutants formed empty, ineffective nodules without understanding the underlying molecular mechanisms .

Middle Period (1990s-2000s): Molecular Function Elucidation
A significant paradigm shift occurred with the molecular characterization of NdvA as an ATP-binding transporter involved in beta-(1-->2)glucan export. The sequencing and analysis of the ndvA gene revealed homology with other bacterial transporters, particularly the hlyB gene from E. coli and chvA from A. tumefaciens . This period established the connection between a specific molecular function (polysaccharide export) and symbiotic phenotypes, fundamentally changing how researchers conceptualized the molecular dialogue between rhizobia and their hosts.

Key discoveries during this period included:

  • Identification of NdvA as a member of the ABC transporter superfamily

  • Recognition that ndvA mutants retained beta-(1-->2)glucan synthesis capability but lacked export

  • Understanding that the ndvA and chvA systems were functionally interchangeable across species

Contemporary Period (2010s-Present): Systems Understanding
The most recent paradigm shift has moved toward understanding NdvA within complex biological systems and networks. Rather than viewing NdvA in isolation, contemporary research examines:

  • Integration in Signaling Networks: How beta-(1-->2)glucan export coordinates with other symbiotic signaling pathways, including Nod factor production and reception

  • Host-Range Determination: Recognition that differential export and composition of beta-(1-->2)glucans may contribute to host specificity, with distinct patterns observed across different Lotus symbiotic compatibility groups

  • Structural Biology Approaches: Movement toward mechanistic understanding through structural studies, examining how NdvA achieves specific substrate recognition and energy-coupled transport

  • Synthetic Biology Applications: Exploring how engineered NdvA variants might be used to modify symbiotic outcomes or develop novel biotechnological applications

This evolution in understanding has been driven by technological advances, moving from traditional genetics to molecular biology, genomics, and now to systems and synthetic biology approaches. Each paradigm shift has brought deeper insights into how this fascinating protein contributes to the ancient and ecologically crucial symbiosis between rhizobia and legumes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.