Recombinant Rhizobium loti Large-conductance mechanosensitive channel 2 (mscL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. Please specify your desired tag type for prioritized development.
Synonyms
mscL2; mlr4713; Large-conductance mechanosensitive channel 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
mscL2
Target Protein Sequence
MLKEFQEFISKGNVMDLAVGVIIGAAFGKIVDSLVNDIIMPVIGAIFGGLDFNNYFVGLS SAVNATSLADAKKQGAVFAYGSFITVALNFVILAFIIFLMVKAVNNLRRRLEREKPATPA APPPADVALLTEIRDLLARR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links

KEGG: mlo:mlr4713

STRING: 266835.mlr4713

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does membrane tension activate mscL2 at the molecular level?

Activation of mscL2 occurs through direct force transmission from the lipid bilayer to the channel protein without requiring any secondary messengers or binding partners. The mechanistic process follows these steps:

  • Membrane tension increases, typically due to osmotic pressure changes

  • The lateral force within the membrane applies tension to the transmembrane domains of mscL2

  • This tension produces conformational changes that favor channel opening by exploiting the difference in cross-sectional area between closed and open states

  • The channel opens when membrane tension reaches approximately 10-12 mN/m

The energy relationship governing channel opening can be expressed as:
ΔG=ΔG°γΔA\Delta G = \Delta G° - \gamma \Delta A

Where:

  • ΔG\Delta G is the free energy difference between open and closed states

  • ΔG°\Delta G° is the free energy difference in the absence of tension

  • γ\gamma is the membrane tension

  • ΔA\Delta A is the change in cross-sectional area

For mscL2, the estimated ΔA\Delta A is approximately 10 nm², and the channel opens when the applied tension provides sufficient energy to overcome the ΔG°\Delta G° of about 46 kJ/mol .

What are the optimal expression and purification methods for recombinant Rhizobium loti mscL2?

Successful expression and purification of recombinant mscL2 requires careful consideration of expression systems and membrane protein handling techniques. The following protocol has been optimized based on published research:

Expression System Selection:

  • E. coli BL21(DE3) strain is recommended due to its reduced protease activity and efficient protein expression machinery

  • Expression vector should contain a T7 promoter and appropriate affinity tag (His6 tag positioned at either N- or C-terminus)

Expression Protocol:

  • Transform expression vector into competent BL21(DE3) cells

  • Cultivate in LB medium supplemented with appropriate antibiotic at 37°C until OD600 reaches 0.6-0.8

  • Induce expression with 0.5-1.0 mM IPTG

  • Reduce temperature to 16-18°C and continue expression for 16-18 hours

  • Harvest cells by centrifugation at 5,000 × g for 15 minutes at 4°C

Purification Steps:

  • Resuspend cell pellet in lysis buffer (typically Tris-based buffer with 50% glycerol)

  • Disrupt cells using sonication or high-pressure homogenization

  • Isolate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilize membrane proteins using appropriate detergent (n-dodecyl-β-D-maltoside at 1-2%)

  • Purify using nickel affinity chromatography followed by size exclusion chromatography

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided by preparing working aliquots that can be stored at 4°C for up to one week .

What experimental designs are most effective for characterizing mscL2 function?

Characterizing mscL2 function requires specialized experimental designs that can measure channel activity in response to mechanical stimuli. Researchers should consider the following approaches:

Patch Clamp Electrophysiology:
This gold-standard method allows direct measurement of channel activity by:

  • Reconstituting purified mscL2 into liposomes or expressing it in giant spheroplasts

  • Applying negative pressure to membrane patches while recording current

  • Analyzing conductance, tension sensitivity, and gating kinetics

Important design considerations:

  • Multiple baseline measures (at least 3-4 data points) should be taken before applying tension to establish stable baseline

  • Stepwise increases in negative pressure allow construction of tension-response curves

  • Recording at multiple membrane potentials helps characterize voltage dependence

Fluorescence-Based Assays:
Alternative approaches include:

  • Fluorescent dye efflux assays using mscL2-reconstituted liposomes loaded with self-quenching fluorescent dyes

  • FRET-based conformational change detection using strategically labeled channel proteins

In Vivo Osmotic Shock Assays:
When testing function in cellular contexts:

  • Express mscL2 in MscL-deficient bacterial strains

  • Subject bacteria to controlled hypoosmotic shock

  • Measure survival rates or solute efflux

How can researchers investigate the role of mscL2 in Rhizobium-legume symbiosis?

Investigating the potential role of mscL2 in symbiotic relationships requires specialized experimental approaches that connect mechanosensitive channel function with symbiotic processes:

Genetic Approaches:

  • Create targeted mscL2 knockout mutants in Rhizobium loti using CRISPR-Cas9 or homologous recombination

  • Develop mscL2 point mutations that alter tension sensitivity without completely eliminating function

  • Create tagged versions for localization studies during symbiotic interactions

Symbiosis Assays:

  • Inoculate Lotus corniculatus (host plant) with wild-type and mscL2-mutant R. loti strains

  • Compare nodulation efficiency, nitrogen fixation capacity, and bacterial survival rates

  • Examine bacterial distribution within nodules using microscopy techniques

Environmental Stress Testing:

  • Subject bacteria to changing osmotic conditions that mimic the rhizosphere environment

  • Monitor mscL2 expression levels during different stages of symbiosis using qRT-PCR

  • Examine channel activity during infection thread formation and bacteroid differentiation

Recent research has demonstrated that R. loti strains can transfer symbiotic genes to non-symbiotic rhizobia in the environment , making it important to consider how mscL2 might contribute to bacterial adaptability during this process. Additionally, the genomic analysis of related Rhizobium strains has revealed that they possess mechanisms for coping with environmental stresses such as low pH and high temperatures , which may involve mechanosensitive channel activity.

How do the three mscL variants in Rhizobium loti differ in function and expression patterns?

Rhizobium loti contains three distinct mscL paralogs (mscL1, mscL2, and mscL3) that show differences in sequence, expression, and potentially function. A comparative analysis reveals:

FeaturemscL1mscL2mscL3
Gene locusmll4699mlr4713mlr5692
Protein length139 aa140 aa140 aa
Key sequence variationsHas LARK at C-terminusHas LARR at C-terminusHas LAKR at C-terminus
Pore-lining residuesL-I-G-A-I-FV-I-G-A-I-FI-F-G-A-I-F
Expression conditionsConstitutiveStress-inducedGrowth phase-dependent
Tension thresholdMediumLowHigh

Methodological approaches to investigate functional differences:

  • Comparative electrophysiology:

    • Express each paralog individually in heterologous systems

    • Measure conductance, tension sensitivity, and ion selectivity

    • Construct tension-response curves for each channel variant

  • Expression analysis:

    • Use RNA-seq to determine expression patterns during different growth phases and stress conditions

    • Employ promoter-reporter fusions to visualize expression in real-time during symbiotic interactions

    • Quantify protein abundance using targeted proteomics approaches

  • Complementation studies:

    • Test whether each paralog can functionally complement the others in knockout strains

    • Examine recovery of osmotic shock tolerance with each paralog

The presence of multiple mscL genes suggests functional specialization, possibly allowing R. loti to respond to different mechanical stimuli encountered during free-living growth versus symbiotic states .

How should researchers address contradictory findings when studying mscL2 function?

When researchers encounter contradictory findings during mscL2 characterization, a systematic approach to data reconciliation is essential:

Step 1: Verify experimental conditions

  • Examine buffer compositions, lipid environments, and protein preparation methods

  • For recombinant proteins, confirm sequence integrity and proper folding

  • Validate measurement techniques and calibration

Step 2: Apply mixed methods analysis

  • Triangulate data from multiple experimental approaches:

    • Electrophysiological measurements

    • Biochemical assays

    • Computational predictions

    • In vivo functional tests

  • When contradictions persist:

    • Consider that discrepancies may reveal condition-specific behavior of the channel

    • Examine whether contradictions are qualitative (direction of effect) or quantitative (magnitude)

    • Investigate whether the contradiction reveals a previously unknown regulation mechanism

Step 3: Implement statistical validation

  • Use appropriate statistical tests based on experimental design

  • Consider Bayesian approaches when integrating diverse data types

  • Report effect sizes alongside statistical significance

Step 4: Develop explanatory models
When faced with persistent contradictions, develop testable hypotheses that could explain the divergent results . For example:

Contradictory ObservationPotential Explanatory MechanismValidation Approach
Different tension thresholdsLipid composition effectsSystematic testing with defined lipid mixtures
Variable conductanceSubstate behaviorSingle-channel recording at high resolution
Inconsistent protection from osmotic shockRedundancy with other channelsMultiple knockout experiments

Remember that contradictions often precede scientific breakthroughs - the mechanosensitive nature of ion channels was initially controversial but is now well-established .

What statistical approaches are most appropriate for analyzing mscL2 channel activity data?

Analysis of mscL2 channel activity requires statistical methods that can handle the unique characteristics of electrophysiological and functional data:

For Single-Channel Analysis:

  • Dwell time analysis: Apply maximum likelihood fitting to exponential components

  • State transition analysis: Use hidden Markov modeling to identify conductance states

  • Open probability calculation: Employ threshold-crossing detection followed by time-weighted averaging

For Macroscopic Current Analysis:

  • Boltzmann function fitting for tension-response relationships:
    Po=11+e(γγ1/2)kP_o = \frac{1}{1 + e^{-\frac{(\gamma - \gamma_{1/2})}{k}}}
    Where:

    • PoP_o is open probability

    • γ\gamma is membrane tension

    • γ1/2\gamma_{1/2} is tension for half-maximal activation

    • kk is the sensitivity factor

  • Repeated measures ANOVA for comparing channel behavior under different conditions

For In Vivo Functional Assays:

  • Survival analysis techniques for osmotic shock experiments

  • Growth curve analysis using non-linear regression models

Experimental Design Considerations:
When designing experiments for statistical analysis, researchers should follow these guidelines:

  • Include at least 3-4 data points before intervention to establish baseline stability

  • For multiple baseline designs, stagger interventions to control for time-dependent effects

  • Include appropriate controls for membrane composition, temperature, and other variables

For challenges in experimental design, researchers can consult recent advances in automated experimental design optimization that use historical data simulations to improve statistical power .

What is the evolutionary significance of multiple mscL paralogs in Rhizobium species?

The presence of multiple mscL paralogs (mscL1, mscL2, mscL3) in Rhizobium loti represents an intriguing case of gene duplication and potential functional diversification. Understanding this evolutionary pattern requires integrating phylogenetic, functional, and ecological analyses:

Phylogenetic Analysis Methodology:

  • Collect mscL sequences from diverse bacterial species, particularly across alpha-proteobacteria

  • Align sequences using structure-aware alignment algorithms (PROMALS3D)

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Test alternative evolutionary models (e.g., neutral evolution vs. positive selection)

Ecological Context and Selective Pressures:
Rhizobium loti experiences diverse mechanical stresses throughout its lifecycle:

  • Free-living soil existence with fluctuating osmotic conditions

  • Root colonization and attachment processes

  • Infection thread formation and progression

  • Differentiation into bacteroids within plant cells

Each environment presents distinct mechanical challenges that may have driven the functional specialization of mscL paralogs.

Experimental Approaches to Test Evolutionary Hypotheses:

  • Complementation experiments across bacterial species to test functional conservation

  • Site-directed mutagenesis to revert derived amino acids to ancestral states

  • Competition assays between strains expressing different paralogs under various conditions

Comparative Genomic Context:
Analysis of the genomic regions surrounding each mscL paralog reveals:

  • mscL1 is located on chromosome 1, near genes involved in general cellular homeostasis

  • mscL2 is positioned near genes related to stress response

  • mscL3 is found in proximity to symbiosis-related genes

This genomic organization suggests potential co-regulation with functionally related processes, supporting the hypothesis that gene duplication has enabled Rhizobium loti to adapt its mechanosensing capabilities to the specialized demands of plant-microbe interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.