Recombinant Rhizobium loti Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Rhizobium loti Lipoprotein Signal Peptidase (LspA) is a bacterial enzyme critical for processing lipoproteins, which are essential components of bacterial cell membranes. LspA, also termed Signal Peptidase II (SPase II), specifically cleaves the signal peptides of prolipoproteins, enabling their maturation and integration into membranes . In Rhizobium loti—a nitrogen-fixing symbiont of legumes like Lotus japonicus—LspA plays a role in maintaining membrane integrity and facilitating host-microbe interactions . Recombinant forms of this enzyme are produced for biochemical studies and industrial applications, leveraging its stability and catalytic specificity.

Protein Architecture

  • Gene Locus: mLr3211 in Mesorhizobium loti MAFF303099 .

  • UniProt ID: Q98GR1 .

  • Protein Length: Recombinant variants include partial sequences (1–168 aa) expressed in yeast and full-length (1–168 aa) versions in E. coli .

  • Post-Translational Modifications: Requires divalent cations for activity and is dependent on oxygen for lipid A oxidation in related pathways .

Biochemical Properties

PropertyDetailsSource
Molecular Weight~35–40 kDa (theoretical)
Purity>85% (SDS-PAGE)
TagHis-tag (N-terminal) in E. coli; tag varies in yeast
Storage Stability6 months (liquid, -20°C/-80°C); 12 months (lyophilized)

Expression Systems

  • Yeast: Partial LspA (1–168 aa) with glycerol stabilization .

  • E. coli: Full-length LspA (1–168 aa) with His-tag for affinity chromatography .

Enzymatic Activity

LspA catalyzes the removal of N-terminal signal peptides from bacterial lipoproteins, a prerequisite for their membrane localization. This activity is critical for:

  • Membrane Biogenesis: Ensuring proper lipoprotein integration into bacterial membranes .

  • Symbiotic Efficiency: Mutations in related genes (e.g., inv locus) disrupt infection thread formation in Lotus nodules .

Role in Lipid A Modification

  • Lipid A Phosphatases: LspA-associated pathways in Rhizobium spp. involve lipid A dephosphorylation (via LpxE/LpxF), enhancing resistance to cationic antimicrobials .

  • Oxidative Modifications: LpxQ, a lipid A oxidase, generates hydrogen peroxide as a byproduct, dependent on LspA-mediated membrane integrity .

Symbiotic Competence

  • Infection Threads: R. loti LspA mutants show impaired intracellular infection in determinate nodules due to defective EPS biosynthesis .

  • Host Specificity: Structural variations in lipid A (e.g., 2-amino-2-deoxygluconic acid) influence nodule persistence and nitrogen fixation .

Stress Resistance

  • Antimicrobial Resistance: Strains lacking lipid A phosphatases (LpxE/LpxF) exhibit polymyxin hypersensitivity, highlighting LspA’s indirect role in stress adaptation .

  • Oxidative Stress: LspA-associated LpxQ activity mitigates reactive oxygen species during symbiosis .

Research Tools

  • ELISA Kits: Detect LspA in bacterial lysates using anti-FLAG or His-tag antibodies .

  • Enzymatic Assays: Monitor peptidase activity via fluorescence-based substrates .

Industrial Relevance

  • Biocatalysis: Engineered LspA variants are explored for lipoprotein processing in synthetic biology .

  • Agricultural Biotechnology: Enhancing rhizobial strains for improved nitrogen fixation in legumes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; mlr3211; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
lspA
Target Protein Sequence
MRSWSPYALLVVAAIALDQWIKHLVETGLPFQEKLDLVPFLALFRTYNTGIAFSMFSSFG DTGLVVIAVLVVAFVLYLATRTPSGHVIARTGFALIIGGALGNLIDRAVYGHVIDYILFH TPVWSFAIFNLADAFISVGAALVVFDELIGWRREPSNAKPSKAKPSKD
Uniprot No.

Target Background

Function

This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.

Database Links

KEGG: mlo:mlr3211

STRING: 266835.mlr3211

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium loti Lipoprotein Signal Peptidase (lspA) and what is its biological function?

Lipoprotein signal peptidase (lspA) in Rhizobium loti (also known as Mesorhizobium loti) is a key enzyme responsible for processing bacterial prelipoproteins by cleaving the signal peptide after lipid modification. The lspA gene (mlr3211) encodes a protein of 168 amino acids which functions as signal peptidase II (SPase II), an essential component of the bacterial lipoprotein processing pathway .

In bacteria, this enzyme plays a crucial role in the maturation of lipoproteins that contribute to various cellular functions including cell envelope integrity, nutrient acquisition, and host-microbe interactions. Unlike in Gram-negative bacteria where lspA is essential, in Gram-positive bacteria such as Staphylococcus aureus, lspA mutants can survive but show reduced virulence and impaired ability to survive in human blood .

How does R. loti lspA contribute to the symbiotic relationship with host plants?

R. loti establishes a symbiotic relationship with legumes of the Lotus genus, forming determinate nodules that enable nitrogen fixation. While the direct role of lspA hasn't been fully characterized in this symbiosis, it likely contributes by processing lipoproteins essential for bacterial cell envelope integrity and host-microbe interactions .

R. loti produces specific lipo-chitin oligosaccharides (LCOs) that are necessary for the nodulation of Lotus plants. These LCOs are N-acetylglucosamine pentasaccharides with specific modifications including N-methylation, N-acylation with cis-vaccenic acid or stearic acid, and carbamoyl groups. The major LCO molecules are substituted on the reducing terminal residue with 4-O-acetylfucose .

When these LCOs are added to Lotus roots, they induce distortion, swelling, and branching of root hairs, while spot inoculation leads to the formation of nodule primordia . Proper processing of bacterial lipoproteins by lspA may be critical for LCO production or delivery during symbiosis.

How does the expression and purification of recombinant R. loti lspA compare with other bacterial lspA proteins?

Expression and purification of recombinant R. loti lspA presents unique challenges compared to other bacterial lspA proteins due to its hydrophobic nature as a membrane protein. The following table compares key aspects of R. loti lspA expression with other bacterial systems:

ParameterR. loti lspAS. aureus lspAE. coli lspA
Expression SystemE. coli Recombinant in E. coli Native
Protein Length168 aa Full length164 aa
Tag SystemN-terminal His Various including HisVarious
SolubilizationRequires detergentsRequires detergentsRequires detergents
Functional AssayNot establishedEnzymatic activity assaysEnzymatic activity assays
CrystallizationNot reportedSuccessful Limited success

Researchers working with R. loti lspA should optimize expression conditions considering its high hydrophobicity. Using E. coli as an expression host with an N-terminal His tag has been successfully employed for obtaining the recombinant protein . Purification typically involves cell lysis, membrane fractionation, detergent solubilization, and affinity chromatography using the His tag.

What methodological approaches can be used to investigate R. loti lspA function in symbiotic interactions?

Several methodological approaches can be employed to investigate the function of R. loti lspA in symbiotic interactions:

  • Gene disruption studies: Creating lspA mutants in R. loti and examining their ability to establish symbiosis with Lotus plants. This approach has been used with other Rhizobium genes, such as nodPQ, which when disabled resulted in a diminished ability to elicit nodules on host legumes .

  • Complementation experiments: Complementing lspA mutants with functional lspA genes to verify the phenotype is directly related to lspA function, similar to how nodPQ mutant phenotypes have been studied .

  • Microscopy techniques: Examining the ultrastructure of the infection process using electron microscopy to observe changes in bacterial cell envelope and infection thread formation.

  • Metabolomic analysis: Investigating changes in LCO production and structure in lspA mutants compared to wild-type strains.

  • Proteomic analysis: Identifying specific lipoproteins affected by lspA mutation using mass spectrometry techniques.

  • Root hair deformation assays: Testing the ability of lspA mutants to induce root hair deformation on Lotus plants, as LCOs from wild-type R. loti have been shown to cause "abundant distortion, swelling and branching of the root hairs" .

How might the lipopolysaccharide structure of R. loti impact the function of membrane proteins like lspA?

The lipopolysaccharide (LPS) structure of R. loti may significantly impact the function of membrane proteins like lspA through several mechanisms:

R. loti produces two structurally different LPS types that can be isolated from aqueous (LPS-W) and phenol (LPS-P) phases. These LPS types differ in their composition and structure, with LPS-P containing large amounts of 6-deoxy-L-talose (6dTal) that is completely absent in LPS-W .

The lipid A moieties of both LPS types show almost identical composition, with six different 3-OH fatty acids and two long-chain 4-oxo-fatty acids that are amide-linked, and with 27-OH-28:0 as the main ester-linked fatty acid. The lipid A is of the lipid ADAG-type, having a phosphorylated 2,3-diamino-2,3-dideoxy-D-glucose-containing backbone .

This unique LPS structure could affect membrane proteins like lspA in several ways:

  • The membrane microenvironment created by these specific LPS structures may influence the folding, stability, and activity of lspA.

  • The unique lipid A composition may alter membrane fluidity and thickness, which can affect the function of membrane-embedded enzymes.

  • The O-antigen composition difference between LPS-W and LPS-P might create heterogeneous membrane domains that could compartmentalize membrane proteins, potentially affecting their local concentration and activity.

What are the optimal conditions for expressing and purifying recombinant R. loti lspA?

Based on available data and similar membrane protein purification protocols, the following methodology is recommended for expressing and purifying recombinant R. loti lspA:

  • Expression system: Use E. coli as the expression host with a vector containing an N-terminal His tag fused to the full-length lspA protein (168 amino acids) .

  • Culture conditions: Grow transformed E. coli in standard media (such as LB) at 30°C rather than 37°C to promote proper folding of the membrane protein. Induce expression with IPTG at a final concentration of 0.1-0.5 mM when cultures reach mid-log phase.

  • Cell lysis: Harvest cells by centrifugation and lyse using either sonication or a French press in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and protease inhibitors.

  • Membrane fraction isolation: Centrifuge the lysate at low speed to remove cell debris, then ultracentrifuge the supernatant to collect the membrane fraction.

  • Protein solubilization: Solubilize the membrane fraction in a buffer containing a suitable detergent such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) at concentrations above their critical micelle concentration.

  • Affinity purification: Purify using Ni-NTA affinity chromatography with an imidazole gradient for elution.

  • Storage: Store the purified protein in a buffer containing Tris/PBS with 6% trehalose at pH 8.0, as recommended for the commercially available protein . Adding 5-50% glycerol to the final preparation is advised for long-term storage at -20°C/-80°C .

How can researchers design experiments to investigate the role of R. loti lspA in polysaccharide sulfation and symbiotic efficiency?

To investigate the role of R. loti lspA in polysaccharide sulfation and symbiotic efficiency, researchers should consider the following experimental design:

  • Generation of lspA mutants: Create knockout or conditional mutants of lspA in R. loti using site-directed mutagenesis, transposon insertion, or CRISPR-Cas9 techniques.

  • Complementation strains: Develop complementation strains by reintroducing the wild-type lspA gene or mutated versions to verify phenotypes and conduct structure-function analyses.

  • Analysis of cell surface polysaccharides:

    • Extract and analyze lipopolysaccharides (LPS) and capsular polysaccharides (KPS) from wild-type and mutant strains.

    • Compare sulfation levels using techniques similar to those used for analyzing nodPQ mutants .

    • Use methods like phenol-water extraction followed by sodium deoxycholate-PAGE, GC-MS, and NMR analysis to characterize polysaccharide structures .

  • Symbiotic efficiency assays:

    • Conduct plant inoculation experiments using Lotus japonicus seedlings.

    • Measure parameters such as:

      • Nodule number and morphology

      • Nitrogen fixation activity (acetylene reduction assay)

      • Plant growth and nitrogen content

    • Compare results between wild-type, lspA mutant, and complemented strains.

  • Competitive nodulation assays: Co-inoculate plants with wild-type and lspA mutant strains at equal ratios, then assess the proportion of nodules occupied by each strain to determine competitive fitness, similar to experiments showing that nodPQ mutants outcompete wild-type M. loti .

  • Cross-talk with nodulation signaling: Investigate how lspA mutation affects the production and structure of lipo-chitin oligosaccharides (LCOs), which are essential nodulation signals .

What analytical techniques are most effective for characterizing the structure-function relationship of R. loti lspA?

To effectively characterize the structure-function relationship of R. loti lspA, researchers should employ the following analytical techniques:

  • Protein structure analysis:

    • X-ray crystallography of purified lspA (similar to the approach used for S. aureus LspA )

    • Cryo-electron microscopy for membrane-embedded visualization

    • Circular dichroism spectroscopy to analyze secondary structure elements

    • NMR spectroscopy for dynamic structural information

  • Site-directed mutagenesis:

    • Target conserved residues based on alignment with other bacterial lspA proteins

    • Create a library of point mutations to identify catalytically important residues

    • Analyze mutant proteins for enzyme activity and substrate binding

  • Enzymatic activity assays:

    • Develop fluorogenic or chromogenic peptide substrates mimicking the lipoprotein signal sequence

    • Measure kinetic parameters (Km, kcat, Vmax) for wild-type and mutant lspA

    • Perform inhibition studies to identify catalytic mechanism

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interaction partners

    • Bacterial two-hybrid assays to study protein interactions in vivo

    • Surface plasmon resonance to measure binding affinities

  • Molecular dynamics simulations:

    • Simulate lspA structure in a membrane environment

    • Analyze substrate binding pocket and catalytic mechanism

    • Predict effects of mutations on protein stability and function

  • In vivo functional analysis:

    • Proteomic analysis of lipoproteins in wild-type vs. lspA mutants

    • Lipidomic analysis to study changes in membrane composition

    • Transcriptomic analysis to identify compensatory mechanisms

How might understanding R. loti lspA contribute to improving agricultural applications of rhizobia?

Understanding R. loti lspA could significantly impact agricultural applications through several avenues:

  • Enhanced symbiotic efficiency: By characterizing how lspA affects lipoprotein processing and subsequently influences nodulation efficiency, researchers could develop rhizobial strains with optimized lspA activity to improve nitrogen fixation capacity and reduce the need for chemical fertilizers.

  • Broader host range engineering: Knowledge of how lspA contributes to host specificity could potentially allow for engineering rhizobial strains capable of nodulating non-traditional host plants, expanding the benefits of biological nitrogen fixation to additional crops.

  • Improved stress tolerance: If lspA-processed lipoproteins contribute to stress responses, this understanding could lead to the development of rhizobial inoculants with improved survival under field conditions such as drought, salinity, or extreme temperatures.

  • Biocontrol applications: Some rhizobial lipoproteins may have roles in suppressing plant pathogens. Understanding lspA's role in processing these proteins could lead to rhizobial strains with enhanced biocontrol properties.

  • Molecular markers for strain selection: The lspA gene and its products could serve as molecular markers for selecting superior rhizobial strains for agricultural inoculants.

What data gaps exist in understanding the comparative biochemistry of lspA across different rhizobial species?

Several significant data gaps exist in our understanding of lspA across different rhizobial species:

The following data table summarizes the current state of knowledge about lspA across different bacterial species:

SpeciesGene SizeProtein LengthEssential?Structural DataKnown SubstratesRole in Symbiosis
R. lotiUnknown168 aa UnknownLimitedNot characterizedNot established
S. aureusKnownFull length No Crystal structure Multiple lipoproteinsN/A
E. coliKnownKnownYesSomeMultipleN/A
Other rhizobiaVariableVariableUnknownLimitedNot characterizedNot established

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.