Recombinant Rhizobium loti Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Protein Nomenclature and Alternative Names

The YidC insertase from Rhizobium loti is known by several alternative names that reflect its functional roles:

NameFunctional Implication
Membrane protein insertase YidCPrimary function in membrane protein insertion
Foldase YidCRole in proper folding of membrane proteins
Membrane integrase YidCIntegration of proteins into lipid bilayers
Membrane protein YidCGeneral classification as a membrane-associated protein

Table 1: Alternative nomenclature for Rhizobium loti YidC protein and their functional implications .

Transmembrane Domain Architecture

YidC insertases possess a characteristic arrangement of five conserved transmembrane (TM) domains that form a pentagonal bundle when viewed from the cytoplasmic side . This arrangement creates a specialized environment at the protein-lipid interface that facilitates the insertion of substrate proteins into the membrane. The organization of these domains follows a specific pattern:

DomainPosition in BundleFunctional Role
TM2Forms part of the hydrophobic coreSubstrate interaction and stabilization
TM3Adjacent to TM2Forms part of the substrate binding groove
TM4Opposite to TM2-TM3 pairContributes to the hydrophobic environment
TM5Adjacent to TM4Structural stabilization
TM6Between TM2 and TM5Completes the pentagonal arrangement

Table 2: Organization and functional roles of the transmembrane domains in YidC proteins .

The Helical Paddle Domain

A distinctive structural feature of YidC proteins is the presence of a helical hairpin between transmembrane segments TM2 and TM3, referred to as the helical paddle domain (HPD). This cytoplasmic structure plays important roles in protein stability and function . The base of this domain is structurally constrained through interactions with TM3, while its tip exhibits greater mobility and interacts with lipid headgroups at the membrane interface .

Functional Mechanisms of YidC Insertase

The primary function of YidC is to facilitate the insertion of membrane proteins into the lipid bilayer. Unlike the Sec translocase, which forms a transmembrane channel that opens laterally to release substrate proteins into the membrane, YidC operates through a distinct mechanism.

Substrate Recognition and Binding

YidC insertases interact with their substrates in a groove-like structure formed at the interface between the protein and the surrounding lipid bilayer . This amphiphilic interface creates a specialized environment that reduces the energetic barrier for the transition of transmembrane segments from the aqueous cytoplasm to the hydrophobic membrane interior . The specific mechanisms of substrate recognition likely involve both hydrophobic interactions and electrostatic complementarity.

Co-translational Insertion Mechanism

A significant aspect of YidC function is its ability to operate co-translationally, interacting directly with translating ribosomes to facilitate the insertion of nascent membrane proteins . Cryo-electron microscopy reconstructions of YidC-ribosome complexes have revealed that a single copy of YidC interacts with the ribosome at the exit tunnel, positioning itself optimally to receive the emerging transmembrane segments of the substrate protein .

This co-translational mode of action ensures that hydrophobic transmembrane segments are efficiently guided into the membrane as they emerge from the ribosome, preventing misfolding or aggregation in the aqueous environment of the cytoplasm. The interaction between YidC and the ribosome appears to involve specific contacts that orient the insertase properly relative to the ribosome exit tunnel .

YidC-Mediated vs. Sec-Dependent Insertion

YidC can function either independently as a membrane protein insertase or in cooperation with the Sec translocase. This functional versatility allows for the insertion of diverse membrane proteins with different characteristics:

Insertion ModeSubstrate CharacteristicsMechanism
YidC-onlySmall proteins with limited periplasmic domainsDirect insertion at protein-lipid interface
YidC-Sec cooperativeLarger proteins with substantial periplasmic domainsSequential or coordinated action with Sec translocase

Table 3: Comparison of YidC-mediated and Sec-dependent insertion pathways .

Critical Residues for YidC Function

Molecular dynamics simulations and mutagenesis studies have identified several residues that are critical for YidC function. While these studies have primarily focused on Escherichia coli YidC, the high conservation of the core functional domains suggests that similar residues are likely important in Rhizobium loti YidC as well.

The transmembrane core of YidC is stabilized by two types of interactions: hydrophobic residues on the exterior interact with lipid tails, while the interior is stabilized by both electrostatic interactions (cytoplasmic side) and aromatic stacking interactions (periplasmic side) . In particular, residues equivalent to T362 in TM2 and Y517 in TM6 of E. coli YidC have been shown to be essential for function, as alanine mutations at these positions completely inactivate the protein despite proper expression and membrane insertion .

The functional importance of these residues suggests that they may be involved in substrate binding or in maintaining the structural integrity of the insertase during the membrane protein integration process.

Applications of Recombinant Rhizobium loti YidC

The availability of recombinant Rhizobium loti YidC provides opportunities for various applications in research and biotechnology. The purified protein can be used for structural studies, functional assays, and as a tool for investigating membrane protein biogenesis.

Enzyme-Linked Immunosorbent Assays (ELISA)

Recombinant Rhizobium loti YidC is available for use in ELISA-based applications, which can be utilized for detecting specific antibodies or studying protein-protein interactions involving the insertase . The standardized preparation of the recombinant protein ensures reproducibility in such assays.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; mlr4812; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-603
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
yidC
Target Protein Sequence
MENNRNFFITIALSVLILAVWQYFYVLPRSEAQREAARVEQQRVEEQKKAAEAANPGAGT PAPAPGTIPNAPGGDTVTVAGRDQALAASKRVKIDTPSLEGSINLTGARLDDLKLKHYTE TVDKNSPEIELLNPQALPTGYFAEIGFVGNDKTGAVPGAETVWNVDGNPTLSPSTPVTLT YTNDKGLTFKRTFSVDANYMFTVSDTVQNSGSSAVSLFNYGRVTRYDKPAVASTYVLHEG LIGFTGTEGLQEHKYASIEKDKQYQPGKATDGWLGITDKYWAVTLVPTEKQPFQPRYAFF EDGRHRYQSDFLTDAINVEAGQSATVETEVFAGAKEVAKINAYAEDRHIKRFDLLIDWGW FHFITKPMFWLIDTLYKFLGNFGLAILATTVIVKALFFPLANKSYASMANMKKVQPKMLE IREKYADDKMKQQQAMMELYKTEKINPLAGCWPVALQIPVFFSLYKVLYITIEMRHAPFF GWIQDLAAPDPTSLFNLFGLIPVTLPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAAI FTWMPVIFTFMMAGFPAGLVIYWAWNNMLSILQQGVIMKRQGAKIELWDNLMALFKKKPS PAE
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It facilitates the integration of membrane proteins dependent and independent of the Sec translocase complex, including some lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins.
Database Links

KEGG: mlo:mlr4812

STRING: 266835.mlr4812

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YidC in bacterial systems?

YidC functions as a membrane protein insertase that facilitates the integration of newly synthesized proteins into lipid bilayers. It operates through two distinct mechanisms: a SecYEG-dependent pathway and a SecYEG-independent pathway . Additionally, YidC serves as a chaperone that assists in proper protein folding within the membrane environment . The protein's hydrophilic groove plays a particularly important role in transporting proteins across the cytoplasmic membrane to the periplasmic side . YidC's chaperoning activity is especially critical for preventing misfolding in structurally complex polytopic membrane proteins .

What is the structural organization of YidC?

YidC consists of multiple transmembrane helices organized in a specific arrangement. According to structural models based on evolutionary co-variation analysis and molecular dynamics simulations, the conserved membrane-integrated core of YidC forms a helical bundle arranged like a pentagon, with the helices ordered 4-5-3-2-6 when viewed from the cytoplasm . Outside the membrane region, YidC contains a cytoplasmic loop between TM2 and TM3 that forms a helical hairpin, termed the "helical paddle domain" (HPD) . This structural organization creates a hydrophilic groove that is essential for YidC's function in membrane protein insertion .

How does YidC interact with ribosomes during co-translational insertion?

Cryo-electron microscopy studies at approximately 8 Å resolution have revealed that YidC binds to the ribosomal exit site during co-translational insertion of membrane proteins . This interaction positions YidC to receive newly synthesized proteins as they emerge from the ribosome. The structural features observed in these studies allowed researchers to dock molecular models of YidC in a distinct orientation, with a cross-correlation coefficient of 0.865 . This positioning facilitates the direct transfer of nascent membrane proteins from the ribosome into the membrane via YidC's hydrophilic groove.

What molecular mechanisms govern YidC-mediated protein insertion?

The YidC-mediated insertion process involves several distinct stages characterized by specific molecular interactions. Based on equilibrium and non-equilibrium molecular dynamics simulations, researchers have proposed a mechanism where the incoming protein first interacts with cytoplasmic loops of YidC before gradually moving into the hydrophilic groove in the transmembrane region . Critical salt-bridge interactions occur during this process, such as between negatively charged residues (e.g., D7) of the substrate protein and positively charged residues (e.g., R72) of YidC .

As the insertion progresses, the substrate protein's N-terminal moves deeper into the groove, followed by dehydration of the groove. The protein then migrates toward the periplasmic side of the membrane, assisted by hydrophobic interactions between the substrate protein's hydrophobic regions and lipid tails outside of YidC's hydrophilic groove . Throughout this process, YidC undergoes significant conformational changes that are essential for facilitating the insertion mechanism.

How do mutations in key YidC residues affect its function?

Molecular dynamics simulations and in vivo complementation assays have identified critical residues in YidC that are essential for its function. Some of the most stabilizing residues include T362 in TM2 and Y517 in TM6, which are located at the same height in the membrane . When these residues are mutated to alanine, YidC is completely inactivated despite being stably expressed, indicating their functional importance rather than structural role .

Other residues, such as F433, M471, and F505, show intermediate activity levels when mutated, while mutations in residues further from the functional core have minimal effects . These findings suggest that specific residue interactions within the transmembrane bundle are critical for YidC's insertase activity, with particular importance for residues involved in stabilizing the core structure through electrostatic interactions (on the cytoplasmic side) and aromatic stacking interactions (on the periplasmic side) .

What is the evolutionary relationship between YidC and SecY?

Comparative structural analyses have revealed surprising similarities between YidC and SecY, suggesting a shared evolutionary origin. Researchers have proposed that SecY originated from a YidC homolog that formed a channel by juxtaposing two hydrophilic grooves in an antiparallel homodimer . This hypothesis is supported by the observation that the hairpin-interrupted three-TMH motif of YidC is strikingly similar to the consensus proto-SecY elements .

Each consensus helix from the YidC family can be matched to a consensus helix from proto-SecY with the same connectivity, making YidC a uniquely good candidate for the origin of proto-SecY . The functional similarity between SecY and YidC as mediators of membrane protein integration further supports this evolutionary relationship. Particularly compelling is the similarity between SecY N.H0 and YidC H0, which provides strong evidence for homology as it is unlikely to result from convergent evolution .

How can molecular dynamics simulations be used to study YidC function?

Molecular dynamics (MD) simulations have proven valuable for investigating YidC's structure and function at the atomic level. Both equilibrium and non-equilibrium MD simulations can be employed to study conformational changes and interactions during the insertion process . When conducting MD studies of YidC, researchers typically:

  • Prepare the system by removing water molecules from crystal structures and assigning appropriate protonation states using software like Molecular Operating Environment (MOE) .

  • Create docking structures of substrate proteins interacting with YidC based on hypothesized stages of the insertion process .

  • Insert YidC into a lipid bilayer (commonly palmitoyloleoyl phosphatidylethanolamine - POPE) using tools like CHARMM-GUI .

  • Solvate the protein-lipid assembly with water layers (approximately 25 Å thick) above and below the membrane .

  • Perform simulations using software like NAMD with appropriate force fields (e.g., CHARMM36m) .

  • Analyze parameters such as root-mean-square deviation (RMSD), radius of gyration, salt-bridge interactions, and hydration/dehydration patterns .

These simulations can reveal critical conformational changes, interaction patterns, and mechanistic details that are challenging to observe experimentally.

What techniques are effective for studying YidC-substrate interactions?

Multiple complementary techniques can be employed to study interactions between YidC and its substrate proteins:

  • Single-molecule force spectroscopy: This technique has been used to monitor how YidC guides the folding of polytopic membrane proteins like melibiose permease (MelB) into membranes . It reveals that substrates form distinct folding cores from which structural segments insert stepwise into the membrane and demonstrates YidC's role in accelerating and chaperoning this process .

  • Cryo-electron microscopy: This approach has been used to visualize YidC bound to ribosomes with nascent chains, providing structural insights into the co-translational insertion process . The resolution (approximately 8 Å) allows for docking molecular models and identifying key interaction regions .

  • In vivo complementation assays: These assays can assess the functional consequences of mutations in specific YidC residues, helping to identify critical regions for YidC activity .

  • Evolutionary co-variation analysis: This computational approach can predict contacts between pairs of residues based on multiple sequence alignments, facilitating the development of structural models even in the absence of crystal structures .

  • Lipid-versus-protein-exposure predictions: These can help determine the orientation of transmembrane helices within the membrane environment .

How can researchers assess YidC's role in membrane protein folding?

To investigate YidC's chaperone function in membrane protein folding, researchers can employ several approaches:

  • Conditional depletion systems: Using E. coli strains with conditionally depleted YidC allows researchers to compare membrane protein insertion and folding in the presence versus absence of YidC .

  • Immunoblotting and quantitative analysis: These techniques can assess protein levels following YidC depletion, providing insights into YidC's impact on specific membrane proteins . For example, studies have shown that levels of certain penicillin-binding proteins remain relatively stable upon YidC depletion, while others may show slight increases or decreases .

  • Bocillin labeling: This approach can be used alongside immunoblotting to analyze membrane proteins in inner membrane vesicles (IMVs) derived from YidC depletion experiments .

  • Statistical analysis: Techniques such as the Kolmogorov-Smirnov test can determine whether the distribution of protein levels is significantly different from normal distribution, helping to assess the statistical significance of observed changes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.