Recombinant Rhizobium loti Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium loti Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA)

Recombinant Rhizobium loti Monofunctional biosynthetic peptidoglycan transglycosylase, denoted as mtgA, is a crucial enzyme involved in the biosynthesis of peptidoglycan, a key component of bacterial cell walls. This enzyme is specifically produced in an in vitro Escherichia coli expression system and is derived from Rhizobium loti, now known as Mesorhizobium loti . The mtgA enzyme plays a significant role in the assembly and maintenance of the bacterial cell wall by catalyzing the formation of glycosidic bonds between disaccharide subunits within peptidoglycan strands.

2.1. Protein Characteristics

  • Sequence and Structure: The mtgA protein sequence is well-defined, with specific motifs that contribute to its enzymatic activity. It is a transmembrane protein, indicating its involvement in cell wall synthesis at the membrane interface .

  • Expression and Tagging: The recombinant mtgA is expressed with an N-terminal 10xHis-tag, facilitating its purification and identification .

  • Storage Conditions: For optimal stability, mtgA should be stored at -20°C or -80°C. Working aliquots can be kept at 4°C for up to one week, but repeated freezing and thawing should be avoided .

2.2. Enzymatic Function

  • Peptidoglycan Synthesis: mtgA is a monofunctional biosynthetic peptidoglycan transglycosylase, meaning it specifically catalyzes the glycosidic bond formation between sugar moieties in peptidoglycan without possessing transpeptidase activity .

  • Role in Bacterial Growth: While mtgA is involved in peptidoglycan synthesis, its deletion in some bacteria does not result in a significant growth phenotype, suggesting redundancy or compensatory mechanisms in cell wall synthesis pathways .

3.1. Studies in Rhizobium loti and Related Species

3.2. Broader Implications for Bacterial Cell Wall Biology

  • Peptidoglycan Dynamics: The dynamic nature of peptidoglycan, involving both synthesis and degradation, is essential for bacterial survival and adaptation. Enzymes like mtgA contribute to this balance by ensuring proper cell wall assembly .

  • Antibiotic Resistance: Understanding the mechanisms of peptidoglycan synthesis and modification can provide insights into developing new antibiotics or enhancing existing ones by targeting specific enzymes involved in cell wall maintenance .

4.1. Characteristics of Recombinant Rhizobium loti mtgA

CharacteristicDescription
Protein TypeTransmembrane Protein
Expression SystemIn vitro Escherichia coli
TagN-terminal 10xHis-tag
Storage Conditions-20°C or -80°C for long-term; 4°C for short-term
SequenceDefined sequence with specific motifs
FunctionMonofunctional biosynthetic peptidoglycan transglycosylase

4.2. Comparison with Other Peptidoglycan Synthesis Enzymes

EnzymeFunctionSpeciesRole in Cell Wall Synthesis
mtgATransglycosylaseMesorhizobium lotiMonofunctional peptidoglycan synthesis
PBP1aBifunctional GTase/TPaseAgrobacterium tumefaciensPrimary enzyme for polar peptidoglycan synthesis
MltE/MltCLytic TransglycosylasesEscherichia coliInvolved in peptidoglycan degradation and remodeling

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize developing your specified tag.
Synonyms
mtgA; mll3783; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
mtgA
Target Protein Sequence
MATRSRGVNRRSLRRWVRRGLVVAAVLALIPTMLTFLYLPSFVHPVSTLMLKDLATFSGY DRRWVSIDDVAPVLAHSVIMSEDGQFCFHRGVDLGELRGVVDDALAGEATRGASTITMQT VKNLFLWSRPLGSVRKVVELPLAVFFDAVMSKRRIMEIYLNIAEWGPGIYGIEAAAQHHF GIPAKQLSRRQAALLAVTLPNPIARNPAKPGPGLRRLANLIERRAGRSGAYVGCLE
Uniprot No.

Target Background

Function
Recombinant *Rhizobium loti* Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: mlo:mll3783

STRING: 266835.mll3783

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of mtgA in Rhizobium loti?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) catalyzes glycan chain elongation during bacterial cell wall synthesis. Unlike bifunctional peptidoglycan synthases that have both glycosyltransferase and transpeptidase activities, mtgA exclusively performs the glycosyltransferase function, polymerizing lipid II into glycan strands. In Rhizobium loti (also known as Mesorhizobium loti), mtgA localizes at the division site and interacts with divisome proteins, indicating its involvement in peptidoglycan formation at new cell poles during bacterial division . This enzyme plays a critical role in maintaining cell wall integrity, which is essential during both free-living growth and symbiotic interactions with host plants.

How does mtgA from R. loti compare to homologous proteins in other bacterial species?

While mtgA proteins share conserved functional domains across bacterial species, research indicates species-specific adaptations in their regulation and interaction networks. In Escherichia coli, mtgA interacts with divisome proteins PBP3, FtsW, and FtsN, similar to what may occur in R. loti . Notably, the enzymatic activity of mtgA from different bacterial species shows varying dependencies on their transmembrane domains. Studies have demonstrated that full-length proteins with intact transmembrane segments exhibit higher activity than truncated forms lacking these domains .

The evolutionary relationships between mtgA proteins across different rhizobial species remain an area requiring further investigation, particularly given the known propensity of rhizobia for horizontal gene transfer of symbiosis-related genes .

What are recommended protocols for expressing and purifying recombinant R. loti mtgA?

Recombinant R. loti mtgA is typically expressed using in vitro E. coli expression systems. Based on commercial preparations, the following conditions are recommended:

ParameterRecommendation
Expression systemIn vitro E. coli expression system
Storage bufferTris-based buffer with 50% glycerol, optimized for protein stability
Storage conditionsPrimary: -20°C; Extended storage: -20°C or -80°C
Working conditionsStore aliquots at 4°C for up to one week
Special considerationsAvoid repeated freezing and thawing

For purification, standard affinity chromatography methods are applicable, though the specific tag (His, GST, etc.) should be determined during the production process to optimize yield and activity .

How can the enzymatic activity of mtgA be measured in vitro?

An established in vitro assay for measuring peptidoglycan glycosyltransferase activity involves monitoring the polymerization of radiolabeled lipid II substrate. The protocol includes:

ComponentSpecification
Substrate14C-GlcNAc-labeled lipid II (9,180 dpm/nmol)
Reaction mixture15% dimethyl sulfoxide, 10% octanol, 50 mM HEPES (pH 7.0), 0.5% decyl-polyethylene glycol, 10 mM CaCl₂
Analysis methodSeparation of products followed by quantification of radiolabeled material
Activity verificationAddition of lysozyme results in complete digestion of polymerized material, confirming peptidoglycan formation
Expected resultsA 2.4-fold increase in peptidoglycan polymerization has been observed when GFP-MtgA is overexpressed compared to controls (26% versus 11% of lipid II used)

This assay provides a quantitative measure of mtgA's capacity to polymerize lipid II into peptidoglycan strands .

What genetic tools are available for studying mtgA function in Rhizobium species?

Several genetic approaches have been developed for functional analysis of genes in rhizobial species, which can be applied to study mtgA:

  • Transposon mutagenesis libraries using mariner or Tn5-based systems for random insertional mutagenesis

  • In vivo expression technology (IVET) to identify genes expressed during specific stages of symbiosis

  • Signature-tagged mutagenesis (STM) for identifying genes important for specific processes like nodulation or rhizosphere colonization

  • Tn-seq for genome-wide functional analysis under various conditions

  • Targeted gene disruption or allelic replacement techniques

  • Fusion proteins (e.g., GFP-MtgA) for localization and functional studies

These approaches have been successfully implemented in various Rhizobium species including R. leguminosarum, S. meliloti, and Mesorhizobium loti, allowing for comprehensive functional characterization of target genes .

How can protein-protein interactions of mtgA be studied in bacterial systems?

Bacterial two-hybrid systems have proven effective for studying mtgA interactions. The methodology involves:

  • Fusing mtgA and potential interaction partners to complementary fragments of adenylate cyclase

  • Co-expressing these constructs in a reporter strain

  • Measuring interaction through restoration of adenylate cyclase activity and subsequent reporter gene expression

This approach has revealed that mtgA interacts with three divisome proteins (PBP3, FtsW, and FtsN) and can also interact with itself, suggesting potential homodimer formation . The strength of these interactions can be quantified by measuring reporter gene expression levels, with values for positive interactions typically being several-fold higher than negative controls.

How does mtgA function during Rhizobium-legume symbiotic interactions?

While direct evidence for mtgA's role in symbiosis is limited in the current literature, its function as a peptidoglycan synthesis enzyme implies a significant role in bacteroid differentiation. During the transition from free-living bacteria to nitrogen-fixing bacteroids within root nodules, rhizobia undergo substantial morphological changes requiring extensive cell wall remodeling . As a peptidoglycan glycosyltransferase, mtgA likely contributes to this remodeling process, potentially influencing:

  • Changes in cell size and shape during bacteroid differentiation

  • Cell wall modifications that affect membrane permeability

  • Resistance to plant defense mechanisms, including antimicrobial peptides produced in nodules

  • Structural integrity of bacteroids within symbiosomes

Research using tagged versions of mtgA could help visualize its localization and activity during different stages of symbiosis, providing insights into its specific contributions to this complex process.

Could mtgA be manipulated to enhance symbiotic nitrogen fixation efficiency?

Genetic manipulation of rhizobial strains to enhance symbiotic performance has primarily focused on nodulation (nod) and nitrogen fixation (nif, fix) genes . While mtgA has not been directly implicated as a target for improving nitrogen fixation efficiency, its role in cell wall biosynthesis suggests several potential avenues for exploration:

  • Modifying mtgA expression levels to optimize bacteroid differentiation

  • Engineering mtgA variants with altered enzymatic properties that might enhance bacteroid stability or function

  • Investigating potential interactions between mtgA and plant-derived factors that influence symbiotic efficiency

How is mtgA expression regulated during different stages of the symbiotic process?

  • Initial colonization of the rhizosphere

  • Infection thread formation and progression

  • Release of bacteria into nodule cells

  • Bacteroid differentiation

  • Mature nitrogen-fixing state

Factors likely to influence mtgA expression include oxygen concentration (microaerobic conditions within nodules), nutrient availability, and plant-derived signals such as flavonoids and nodule-specific cysteine-rich (NCR) peptides. Studies comparing mtgA expression between free-living bacteria and bacteroids isolated from different stages of nodule development would provide valuable insights into its regulation during symbiosis.

How does the transmembrane domain of mtgA influence its enzymatic activity?

The transmembrane (TM) segment of glycosyltransferases, including mtgA, plays a crucial role in enzyme function. Research with other peptidoglycan glycosyltransferases has demonstrated that:

  • Full-length proteins with TM segments exhibit significantly higher activity than truncated forms lacking these domains

  • The TM segment influences substrate and inhibitor (e.g., moenomycin) binding

  • TM domains can affect the glycan chain length produced by the enzyme

  • Protein-protein interactions, particularly within the divisome complex, may be mediated by TM domains

For example, studies with Streptococcus pneumoniae PBP2a found that its TM domain influenced the length of glycan chains produced . Similar effects might be expected for R. loti mtgA, suggesting that experimental designs should carefully consider whether to include the TM domain when expressing recombinant protein, as this decision may significantly impact observed enzymatic properties.

What is the relationship between mtgA and other peptidoglycan synthesis enzymes in R. loti?

The peptidoglycan synthesis machinery involves multiple enzymes with complementary and sometimes redundant functions. While specific information about R. loti is limited, studies in E. coli suggest that mtgA may have functional relationships with:

  • Bifunctional class A penicillin-binding proteins (PBPs) like PBP1a and PBP1b

  • Class B PBPs involved in transpeptidation, particularly PBP3 (FtsI)

  • Other divisome components like FtsW and FtsN

Evidence suggests that mtgA can partially compensate for the absence of bifunctional PBP1b and thermosensitive PBP1a in E. coli, demonstrating functional redundancy in the peptidoglycan synthesis system . This has implications for understanding how bacteria maintain cell wall integrity under various conditions and how they might respond to antibiotics targeting specific components of the peptidoglycan synthesis machinery.

How do horizontal gene transfer events impact mtgA evolution in rhizobial species?

Horizontal gene transfer (HGT) is a significant evolutionary mechanism in rhizobial species, particularly for genes involved in symbiotic interactions. While the search results don't specifically address HGT of mtgA, several principles can be inferred:

  • Symbiosis islands containing multiple genes can be transferred between rhizobial strains, potentially creating new combinations of cell wall synthesis genes and symbiotic genes

  • Transfer of symbiotic plasmids between strains can result in bacteria with altered nodulation and nitrogen fixation capabilities

  • The acquisition of new genetic material through HGT can alter competitive fitness and host range

A comparative genomic analysis of mtgA across rhizobial species could reveal evidence of HGT events and provide insights into how this gene has evolved in different lineages. Such analysis might also identify correlations between mtgA variants and symbiotic capabilities, suggesting functional relationships worth exploring experimentally.

How might CRISPR-Cas9 technology be applied to study mtgA function in R. loti?

CRISPR-Cas9 genome editing offers precise manipulation of bacterial genomes and could be applied to study mtgA in several ways:

  • Generation of clean mtgA deletion mutants to assess its essentiality and phenotypic effects

  • Introduction of point mutations to study structure-function relationships within the protein

  • Creation of domain swaps between mtgA orthologs from different species to identify species-specific adaptations

  • Development of CRISPRi systems for conditional knockdown of mtgA expression

  • Creation of fluorescent protein fusions at the native locus for precise localization studies

While CRISPR-Cas9 systems have been adapted for various rhizobial species, specific protocols would need to be optimized for R. loti. The ability to make precise genetic modifications would significantly advance our understanding of mtgA function in both free-living and symbiotic states.

Could mtgA be a target for developing novel biotechnological applications in agriculture?

The role of mtgA in cell wall synthesis and potentially in symbiotic interactions suggests several biotechnological applications:

  • Development of rhizobial inoculants with optimized mtgA expression for enhanced symbiotic performance

  • Creation of biosensors using mtgA-reporter fusions to monitor bacterial responses to environmental conditions

  • Design of synthetic biology approaches to engineer novel cell wall properties that enhance bacterial survival in agricultural soils

  • Exploration of mtgA as a target for compounds that could selectively enhance beneficial rhizobial species while inhibiting plant pathogens

What high-throughput approaches could advance our understanding of mtgA function?

Several high-throughput methodologies could accelerate research on mtgA:

  • Transposon-sequencing (Tn-seq) to identify genetic interactions between mtgA and other genes under various conditions, including during symbiosis

  • RNA-seq to characterize the transcriptional response to mtgA deletion or overexpression

  • Proteomics to identify changes in protein abundance and post-translational modifications associated with mtgA activity

  • Metabolomics to detect alterations in cell wall precursors and other metabolites in mtgA mutants

  • High-throughput phenotyping of mtgA variants to correlate sequence changes with functional outcomes

Such approaches would generate comprehensive datasets that could reveal unexpected functions and regulatory relationships involving mtgA. Combined with computational modeling of peptidoglycan synthesis and bacterial cell division, these approaches could provide a systems-level understanding of mtgA's role in bacterial physiology and symbiotic interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.