Recombinant Rhizobium loti Probable intracellular septation protein A (mlr4321)

What is the molecular structure and function of Rhizobium loti Probable intracellular septation protein A?

Rhizobium loti Probable intracellular septation protein A (mlr4321) is a 224-amino acid hydrophobic protein involved in bacterial cell division processes. The full amino acid sequence is: MNPPILERDPSDPQKEKKEGVNPVLKLVLELGPLLVFFFANARGEWLVQKFPVLGEFGGPIFVATGLFMAATAIALIASWLLTRTLPIMPMVSGVVVFIFGALTLYLQDDIFIKMKPTIVNTLFGGVLLGGLYFGRSLLGYVFDSAFRLDAEGWRKLTFRWGLFFLFLAVVNEVVWRNFSTDAWVTFKVWGIMPITLLFTFSQMPLILRHSLDDKASGEEKAGK .

Based on comparable proteins like ispA in Shigella flexneri, this protein likely plays a critical role in intracellular septation during bacterial cell division. Research on related proteins suggests that defects in this protein can lead to filamentous bacterial growth with impaired septum formation . While the exact mechanism remains under investigation, structural analyses indicate multiple transmembrane domains consistent with its role in cell membrane organization during division.

What are the optimal storage and handling conditions for Recombinant Rhizobium loti Probable intracellular septation protein A?

For maximum stability and activity preservation, the recombinant protein should be stored at -20°C for regular use or -80°C for extended storage periods . The commercial preparation is typically supplied in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein's stability .

Researchers should aliquot the stock solution upon receipt to minimize freeze-thaw cycles, as repeated freezing and thawing significantly reduces protein activity. Working aliquots can be maintained at 4°C for up to one week without significant degradation . When designing experiments, consider the protein's hydrophobic nature, which may influence its solubility and interaction properties in various buffer systems.

How does Recombinant Rhizobium loti mlr4321 compare structurally and functionally to septation proteins in other bacterial species?

Comparative genomic and proteomic analyses reveal that mlr4321 shares significant structural and functional homology with intracellular septation proteins from various bacterial species. In particular, it bears notable similarities to the ispA protein identified in Shigella flexneri, which has been characterized as an essential gene affecting cell division processes .

The homology table below outlines key comparisons between mlr4321 and related proteins:

*Estimated based on reported functional conservation and size similarity

The functional parallels between these proteins suggest conserved mechanisms for bacterial cell division across species, although species-specific variations likely reflect adaptations to different ecological niches and cell envelope architectures.

What are the recommended protocols for expressing and purifying Recombinant Rhizobium loti Probable intracellular septation protein A?

When designing expression systems for mlr4321, researchers should consider the protein's highly hydrophobic nature, which presents challenges for soluble expression. Based on experiences with similar membrane-associated proteins, the following expression and purification approach is recommended:

• Expression System Selection:

  • E. coli BL21(DE3) or similar strains designed for membrane protein expression

  • Consider using specialized vectors containing solubility-enhancing tags (MBP, SUMO, or TRX)

  • Codon optimization may improve expression levels significantly

• Culture Conditions:

  • Lower induction temperatures (16-20°C) typically yield better folding

  • Extended expression periods (16-24 hours) at lower IPTG concentrations (0.1-0.3 mM)

  • Addition of membrane-stabilizing agents in growth media

• Purification Strategy:

  • Two-phase extraction using detergent solubilization (mild non-ionic detergents like DDM or LDAO)

  • Immobilized metal affinity chromatography followed by size exclusion chromatography

  • Consider on-column refolding if inclusion bodies form

When working with this hydrophobic protein, optimization of detergent concentration is crucial for maintaining protein stability while achieving sufficient purity for downstream applications.

What functional assays can be used to study the septation activity of mlr4321?

To investigate the functional properties of mlr4321, researchers can implement several complementary approaches:

• Genetic Complementation Assays:

  • Knockout/complementation studies in Rhizobium loti or heterologous systems

  • Microscopic evaluation of septation phenotypes (similar to the approach used for ispA in Shigella)

  • Quantification of filamentous growth patterns using automated imaging systems

• Protein-Protein Interaction Studies:

  • Bacterial two-hybrid or split-GFP assays to identify binding partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling approaches (BioID or APEX) to map the interactome

• Localization Studies:

  • Fluorescent protein tagging with time-lapse microscopy during cell division

  • Immunogold electron microscopy to visualize precise subcellular localization

  • FRAP (Fluorescence Recovery After Photobleaching) to analyze protein dynamics

• In vitro Activity Assays:

  • Liposome association/perturbation assays

  • Membrane protein reconstitution systems

  • GTPase activity measurements (if GTP-binding domains are present)

These methodological approaches should be selected based on specific research questions and available resources, with appropriate controls to account for potential artifacts introduced by protein tags or expression systems.

How can researchers effectively use site-directed mutagenesis to analyze mlr4321 structure-function relationships?

Site-directed mutagenesis represents a powerful approach for dissecting the relationship between protein structure and function in mlr4321. Based on sequence analysis and hydrophobicity predictions, the following strategy is recommended:

• Target Selection:

  • Highly conserved residues across bacterial septation proteins

  • Predicted transmembrane domains (approximately residues 50-70, 90-110, 140-160, and 180-200)

  • Charged residues in predicted loop regions

• Mutation Design Strategy:

  • Conservative substitutions to probe specific interactions

  • Alanine scanning of predicted functional domains

  • Introduction of reporter residues (cysteine for labeling studies)

• Recommended Mutations for Initial Analysis:

• Phenotypic Analysis:

  • Microscopic evaluation of cell division

  • Growth curve analysis under various conditions

  • Protein localization changes using fluorescent tagging

  • Interaction profile alterations using pull-down assays

The mutational analysis should be conducted systematically, with careful documentation of expression levels and proper controls to distinguish between direct functional effects and indirect consequences of protein destabilization.

How does mlr4321 contribute to symbiotic relationships in Rhizobium loti?

Unlike the virulence-associated role of ispA in Shigella flexneri , the mlr4321 protein in Rhizobium loti likely plays a specialized role in the context of plant-microbe symbiosis. Research approaches to investigate this aspect should include:

• Comparative Phenotypic Analysis:

  • Nodulation efficiency studies comparing wild-type and mlr4321 mutant strains

  • Microscopic evaluation of bacteroid formation and persistence

  • Plant growth promotion measurements under controlled conditions

• Molecular Signaling Investigation:

  • Transcriptomic profiling during symbiotic stages

  • Analysis of mlr4321 expression in response to plant flavonoids

  • Potential regulatory connections to the nod and fix gene clusters

• Host-Microbe Interface Studies:

  • Infection thread formation and progression

  • Bacteroid differentiation dynamics

  • Metabolic exchange profiling within nodules

Current evidence suggests that proper bacterial cell division, mediated in part by septation proteins like mlr4321, is essential for establishing and maintaining functional symbiotic relationships. The specialized environment within root nodules may impose unique constraints on bacterial division processes that are facilitated by this protein.

What computational approaches can predict interaction partners and regulatory networks involving mlr4321?

Advanced computational methods offer valuable insights into the functional context of mlr4321:

• Protein-Protein Interaction Prediction:

  • Homology-based inference from known interaction networks

  • Machine learning approaches incorporating sequence, structure, and co-expression data

  • Molecular docking simulations with predicted binding partners

• Integration with Multi-omics Data:

  • Correlation analysis with transcriptomic profiles across conditions

  • Metabolic modeling to predict functional impacts

  • Protein co-evolution analysis to identify functionally linked proteins

• Regulatory Network Construction:

  • Promoter analysis for transcription factor binding sites

  • Small RNA interaction prediction

  • Post-translational modification site prediction

Predicted functional partners likely include cell division proteins (FtsZ, FtsA), peptidoglycan synthesis enzymes, and potentially symbiosis-specific factors unique to Rhizobium species. Computational predictions should be validated experimentally using targeted protein-protein interaction assays or genetic approaches.

What are the challenges and solutions for structural determination of mlr4321?

As a highly hydrophobic membrane protein, mlr4321 presents significant challenges for structural determination. Researchers should consider the following approaches:

• Crystallography Challenges and Solutions:

  • Detergent screening is critical (typically requiring 50+ detergents)

  • Lipidic cubic phase (LCP) crystallization may improve success rates

  • Fusion partners (T4 lysozyme, BRIL) can enhance crystallizability

  • Antibody fragment co-crystallization can stabilize flexible regions

• Cryo-EM Approaches:

  • Reconstitution in nanodiscs or amphipols to maintain native-like environment

  • Focused refinement strategies for flexible domains

  • Leveraging new developments in micro-ED for small crystals

• NMR Strategies:

  • Selective isotope labeling of specific residues

  • Solid-state NMR approaches for membrane-embedded segments

  • Fragment-based analysis of soluble domains

• Hybrid Methods:

  • Integrating low-resolution experimental data with computational modeling

  • Cross-linking mass spectrometry to establish distance constraints

  • Evolutionary coupling analysis to predict contact maps

These approaches require specialized expertise and equipment, often necessitating collaborative efforts between structural biology laboratories and protein biochemistry groups.

How should researchers analyze contradictory experimental results regarding mlr4321 function?

When facing contradictory results in mlr4321 research, implement this systematic approach:

• Experimental Context Analysis:

  • Compare experimental conditions (buffer composition, pH, temperature, protein concentration)

  • Assess protein preparation methods and quality control metrics

  • Evaluate the sensitivity and specificity of detection methods

• Strain-Specific Variations:

  • Document genetic background of bacterial strains used

  • Consider potential compensatory mechanisms in different genetic backgrounds

  • Evaluate the presence of paralogs that might compensate for mlr4321 mutations

• Methodological Resolution Strategies:

  • Perform complementary assays using different principles

  • Utilize genetic approaches alongside biochemical methods

  • Implement time-course studies to capture dynamic effects

• Reconciliation Framework:

When reporting apparently contradictory results, researchers should explicitly address methodological differences and propose testable hypotheses that might reconcile the conflicting observations.

What statistical approaches are most appropriate for analyzing mlr4321 mutant phenotypes?

The appropriate statistical analysis depends on the specific experimental design and data characteristics:

• Growth and Morphology Analysis:

  • For continuous variables (cell length, division time): ANOVA with appropriate post-hoc tests

  • For categorical data (morphology classes): Chi-square or Fisher's exact test

  • For time-course experiments: Repeated measures ANOVA or mixed-effects models

• Microscopy Data Analysis:

  • Quantitative image analysis requires standardized thresholding methods

  • Consider machine learning approaches for unbiased morphological classification

  • Account for cell-to-cell variability using population distribution analysis rather than simple means

• Interaction Studies:

  • Establish clear statistical thresholds for significant interactions

  • Implement multiple testing corrections for large-scale studies

  • Consider Bayesian approaches for integrating prior knowledge

• Sample Size Considerations:

  • Power analysis should be performed prior to experiments

  • For microscopy: typically 100-300 cells per condition

  • For growth studies: minimum 3 biological replicates with 3 technical replicates each

How can researchers integrate findings about mlr4321 with broader knowledge of bacterial cell division?

To place mlr4321 research within the broader context of bacterial cell division:

• Comparative Analysis Framework:

  • Align findings with established cell division models (E. coli, B. subtilis)

  • Identify conserved versus Rhizobium-specific aspects of septation

  • Map interactions with core division proteins (FtsZ, FtsA, ZipA)

• Evolutionary Context:

  • Phylogenetic analysis of septation protein families

  • Correlation with cell envelope architecture across species

  • Assessment of selection pressures in symbiotic versus free-living bacteria

• Systems Biology Integration:

  • Position mlr4321 within cell cycle regulatory networks

  • Connect septation processes to metabolism and environmental response

  • Develop predictive models of cell division incorporating mlr4321 function

• Multi-Scale Modeling:

  • Molecular dynamics simulations of protein-membrane interactions

  • Mesoscale models of septum formation

  • Whole-cell models incorporating divisome assembly and function

This integrative approach helps researchers avoid isolated interpretations and facilitates the development of comprehensive models that explain both mlr4321-specific findings and general principles of bacterial cell division.

What emerging technologies might advance understanding of mlr4321 function?

Several cutting-edge technologies hold particular promise for mlr4321 research:

• Advanced Imaging Approaches:

  • Super-resolution microscopy (PALM/STORM) for precise localization mapping

  • Light-sheet microscopy for long-term live cell imaging with minimal phototoxicity

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

• Genome Engineering Tools:

  • CRISPR interference for tunable gene expression modulation

  • Base editing for precise amino acid substitutions without selection markers

  • Optogenetic tools for temporal control of protein activity

• Single-Cell Technologies:

  • Single-cell transcriptomics during cell division and symbiotic stages

  • Microfluidic approaches for controlled environmental perturbations

  • Single-molecule tracking to analyze protein dynamics in vivo

• Structural Biology Advances:

  • Improved cryo-EM approaches for membrane proteins

  • Integrative structural modeling combining multiple data sources

  • Hydrogen-deuterium exchange mass spectrometry for mapping conformational changes

These technologies will enable researchers to address previously intractable questions about mlr4321 function and regulation with unprecedented spatial and temporal resolution.

How might findings about mlr4321 translate to applications in synthetic biology and biotechnology?

Understanding mlr4321 function presents several translational opportunities:

• Engineered Symbiotic Systems:

  • Optimization of Rhizobium-legume interactions for enhanced nitrogen fixation

  • Development of synthetic symbioses with non-legume crops

  • Creation of biosensors for monitoring plant-microbe interactions

• Controlled Cell Division Applications:

  • Engineered growth control systems for bioproduction strains

  • Synchronized cell division for improved metabolic engineering

  • Morphological engineering for enhanced surface properties

• Antimicrobial Development:

  • Identification of new targets in the bacterial division machinery

  • Design of species-selective growth inhibitors

  • Combination approaches targeting multiple divisome components

• Protein Engineering Platforms:

  • Development of membrane protein expression and display systems

  • Creation of synthetic cell division modules with tunable properties

  • Establishing minimal divisome systems for synthetic cells

These applications require detailed mechanistic understanding and careful optimization but could ultimately lead to significant biotechnological innovations.