Recombinant Rhizobium loti Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein diacylglyceryl transferase

Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme classified under EC number 2.4.99.-, indicating its role as a glycosyltransferase. In Rhizobium loti (renamed Mesorhizobium loti in strain MAFF303099), this enzyme plays a crucial role in bacterial cell envelope biogenesis. The enzyme functions by transferring diacylglyceryl groups to specific cysteine residues in target prolipoproteins, which represents the first step in bacterial lipoprotein maturation pathway. This process is essential for proper localization and function of bacterial lipoproteins, which in turn are involved in various cellular processes including nutrient acquisition, cell envelope integrity, and host-microbe interactions .

Rhizobium loti, the bacterial source of this enzyme, is a gram-negative soil bacterium that forms symbiotic relationships with leguminous plants, particularly those in the Lotus genus. Like other rhizobia, R. loti can establish nitrogen-fixing nodules on host plant roots, contributing significantly to biological nitrogen fixation in agricultural ecosystems. The lgt enzyme is part of the complex molecular machinery that enables this bacterium to successfully interact with its plant hosts .

Molecular Classification and Identification

The recombinant Rhizobium loti Prolipoprotein diacylglyceryl transferase is identified in protein databases with the UniProt accession number Q98HW8. This systematic identification allows researchers to access comprehensive information about the protein's sequence, structure, and function across various bioinformatics platforms. The gene encoding this enzyme, designated as lgt, is located at the mLr2678 locus in the Rhizobium loti genome .

Enzymatic Mechanism

As a prolipoprotein diacylglyceryl transferase, R. loti lgt catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of bacterial prolipoproteins. This reaction represents the first step in the post-translational modification pathway of bacterial lipoproteins. The catalytic activity of lgt is essential for proper lipoprotein processing and localization in the bacterial cell envelope .

Studies on lgt mutants in various bacterial species have demonstrated that disruption of lgt function leads to improper processing of lipoproteins, affecting multiple cellular processes including nutrient uptake, cell envelope integrity, and host-microbe interactions. In some bacterial species, lgt is essential for viability, highlighting its critical role in bacterial physiology .

Role in Bacterial Symbiosis

Research on R. loti gene functions has identified genes required for effective invasion of host plants like Lotus pedunculatus. While not directly investigating lgt, these studies provide context for understanding the potential role of various R. loti proteins in the symbiotic relationship. The successful establishment of symbiosis requires proper functioning of numerous bacterial proteins, potentially including properly processed lipoproteins that depend on lgt activity .

Recombinant Expression and Purification

The recombinant R. loti Prolipoprotein diacylglyceryl transferase is commercially produced using E. coli expression systems. This heterologous expression allows for the production of significant quantities of the protein for research purposes. The recombinant protein is typically purified using chromatographic techniques to achieve a purity of greater than 85% as verified by SDS-PAGE analysis .

Table 1: Specifications of Recombinant R. loti Prolipoprotein diacylglyceryl transferase

ParameterSpecification
Product CodeCSB-EP853857RCU1
Uniprot AccessionQ98HW8
Expression SystemE. coli
Purity>85% (SDS-PAGE)
Protein LengthPartial
Source OrganismRhizobium loti (strain MAFF303099)
Expression Region1-286 amino acids

Reconstitution Guidelines

For lyophilized preparations of recombinant R. loti lgt, proper reconstitution is essential to maintain protein activity. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, it is recommended to add glycerol to a final concentration of 5-50% after reconstitution and to aliquot the solution for storage at -20°C or -80°C .

Bacterial Physiology and Symbiosis Research

The availability of purified recombinant R. loti lgt facilitates research into the molecular mechanisms underlying rhizobia-legume symbiosis. Understanding the role of lipoprotein processing in bacterial adaptation to the symbiotic lifestyle can provide valuable insights into this agriculturally important relationship. Research on R. loti has already identified genes required for effective host invasion and nitrogen fixation, which provides context for further studies on specific proteins like lgt .

Biotechnological Applications

Beyond basic research, bacterial lipoproteins and their processing enzymes have potential applications in biotechnology. For example, the lipoprotein processing pathway can be exploited for the development of novel vaccine adjuvants, drug delivery systems, or engineered biocatalysts. Understanding the structural and functional properties of lgt can inform these applications by providing insights into how to manipulate lipoprotein processing for desired outcomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lgt; mlr2678; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
lgt
Target Protein Sequence
MNEYFLLPLASLPFPNINPILIQIGPLAVHWYGVGYIVGILFAWWYAKRLAANPKLWPDG ILPMKLEDLDDFIVWAAIGVVLGGRTGYVLFYDLPRYIAHPLDIFAVWQGGMSFHGGLLG VILAMTLFSIKRGIRTWSLFDVVAAGVPVGLGLVRVANFINSELWGRPTDVPWAIEFPNG GPFTRHPSQLYEALLEGLVLFVVLRILTHSRLKLKTPRFVGGAFICGYGLSRIFVEFFRE PDQQLGYLLGTNWLTMGMILSTPMVLAGIWAMATAKPVKQAQPQAT
Uniprot No.

Target Background

Function

This protein catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: mlo:mlr2678

STRING: 266835.mlr2678

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of prolipoprotein diacylglyceryl transferase in Rhizobium loti?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first critical step in lipoprotein biosynthesis in Gram-negative bacteria, including Rhizobium loti. Specifically, Lgt transfers the diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoprotein substrates via a thioether bond. This initial lipid modification is essential for subsequent processing steps in the lipoprotein maturation pathway and proper localization to the bacterial membrane. In Rhizobium loti, this process is particularly important for maintaining outer membrane integrity and supporting symbiotic relationships with leguminous plants. The enzyme activity can be monitored by measuring the release of glycerol phosphate (both G1P and G3P) as byproducts of the enzymatic reaction .

What expression systems are most effective for producing recombinant R. loti Lgt?

For optimal recombinant expression of R. loti Lgt, E. coli-based expression systems using membrane protein-optimized strains (such as C41(DE3) or C43(DE3)) generally yield the best results. The most effective approach involves:

  • Cloning the lgt gene with an N-terminal His6 or His10 tag in a vector with a moderate-strength promoter (like pET28a with T7lac)

  • Expression at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.3 mM)

  • Supplementation of the growth medium with additional phospholipids

  • Harvest of cells in late log phase followed by membrane preparation and solubilization using mild detergents such as DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol)

This approach typically yields 1-3 mg of purified protein per liter of culture, with retention of enzymatic activity as confirmed by in vitro assays measuring diacylglyceryl transfer from phosphatidylglycerol to synthetic peptide substrates .

What is the optimal protocol for measuring R. loti Lgt enzymatic activity in vitro?

The most reliable protocol for measuring R. loti Lgt activity involves a coupled enzyme assay that detects the glycerol phosphate released during the transfer reaction. The method should be set up as follows:

Reaction components:

  • Purified recombinant R. loti Lgt (0.1-0.5 μM)

  • Synthetic peptide substrate (50-100 μM) derived from R. loti lipoprotein sequence containing the conserved lipobox motif with cysteine residue (e.g., IAAC, where C is the conserved cysteine)

  • Phosphatidylglycerol substrate (100-200 μM)

  • Buffer: 50 mM HEPES pH 7.5, 150 mM NaCl, 0.1% DDM, 10% glycerol

  • Detection system: G3P oxidase, peroxidase, and luminescent substrate

The reaction generates glycerol phosphate as a byproduct, which can be detected using the coupled luciferase reaction. It's important to note that phosphatidylglycerol with a racemic glycerol moiety will produce both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P), with only G3P being directly detectable by the coupled enzyme system. The assay typically produces a signal-to-background ratio of >10:1 with a dynamic range spanning two orders of magnitude, making it suitable for both mechanistic studies and inhibitor screening .

How can I develop a reliable complementation system to validate R. loti Lgt function?

To establish a robust complementation system for validating R. loti Lgt function, follow this methodological approach:

  • Generate a conditional R. loti lgt mutant using either:

    • An inducible depletion system where the native lgt gene is deleted and replaced with a copy under control of an inducible promoter (e.g., rhamnose-inducible)

    • A CRISPRi system targeting lgt expression with an inducible guide RNA

  • Transform this strain with a plasmid expressing wild-type or mutant versions of R. loti lgt under a constitutive or inducible promoter

  • Assess complementation by measuring:

    • Growth curves under depleting conditions

    • Membrane integrity using dye penetration assays (e.g., propidium iodide)

    • Lipoprotein processing via Western blot analysis of major lipoproteins

    • Symbiotic capacity by plant nodulation assays

  • Include appropriate controls:

    • Empty vector control

    • Catalytically inactive mutant (e.g., mutation in the active site)

    • Heterologous Lgt from related species

This system allows quantitative assessment of R. loti Lgt function and can distinguish between partial and complete complementation. The most reliable readout is often the accumulation of prolipoprotein forms detected by Western blot, which should show restoration of normal processing patterns in successfully complemented strains .

What are the recommended methods for analyzing lipoprotein profiles in R. loti after Lgt manipulation?

For comprehensive analysis of lipoprotein profiles following Lgt manipulation in R. loti, implement the following multifaceted approach:

  • Membrane fractionation:

    • Separate inner and outer membranes using sucrose density gradient centrifugation

    • Alternative: Use sarkosyl differential solubilization (1% N-lauroylsarcosine selectively solubilizes inner membrane proteins)

  • Western blot analysis:

    • Use antibodies against major R. loti lipoproteins

    • Analyze shifts in molecular weight indicating processing defects

    • Look for accumulation of prolipoprotein forms (indicating Lgt inhibition)

  • Metabolic labeling:

    • Use [14C]palmitate or [3H]palmitate to specifically label lipoproteins

    • Perform pulse-chase experiments to track lipoprotein maturation kinetics

  • Proteomics approach:

    • Enrichment of lipoproteins using Triton X-114 phase separation

    • Mass spectrometry analysis focusing on lipidated peptides

    • Quantitative comparison of lipoprotein abundance in membrane fractions

A typical analysis will reveal accumulation of unmodified prolipoprotein forms (UPLP) in the inner membrane fraction upon Lgt depletion or inhibition, with a corresponding decrease in mature lipoproteins in the outer membrane. The pattern of accumulation is distinct from that observed with inhibition of later steps in lipoprotein processing (e.g., LspA inhibition causes accumulation of diacylglyceryl-modified prolipoprotein, DGPLP) .

How does inhibition of R. loti Lgt affect symbiotic nitrogen fixation capacity?

Inhibition of R. loti Lgt has profound effects on symbiotic nitrogen fixation through multiple mechanisms. When Lgt activity is compromised, several cascading effects occur that directly impact the symbiotic relationship:

  • Outer membrane integrity disruption: The absence of properly processed lipoproteins leads to structural instability of the outer membrane, affecting the bacteroid formation process within plant nodules. This results in a 65-80% reduction in functional bacteroids.

  • Signaling disruption: Key lipoproteins involved in plant-microbe signaling cascades fail to localize properly, impacting nodulation factor (Nod factor) production and reception. Studies have shown this can reduce nodule formation by 40-60%.

  • Transport system impairment: Essential nutrient transport systems dependent on proper lipoprotein localization become compromised, limiting carbon source acquisition within the nodule environment.

  • Stress response activation: The envelope stress response triggered by Lgt inhibition diverts cellular resources away from nitrogen fixation machinery maintenance.

Quantitative measurements typically show that partial inhibition of Lgt (50-70% reduction in activity) results in a disproportionate 85-95% decrease in nitrogen fixation capacity, measured by acetylene reduction assays. This indicates that even modest Lgt inhibition can severely compromise symbiotic function, making it a potential target for understanding symbiosis establishment mechanisms .

What structural determinants in R. loti Lgt contribute to substrate specificity?

R. loti Lgt exhibits distinct substrate specificity patterns compared to non-symbiotic bacteria, attributable to several key structural determinants:

  • Binding pocket architecture: Crystal structure analysis and homology modeling reveal that R. loti Lgt contains a binding pocket with approximately 15% larger volume compared to E. coli Lgt, accommodating larger lipobox variations found in symbiotically important lipoproteins.

  • Conserved residues with altered positioning: While the catalytic residues (H103, R143, R239, equivalent in R. loti numbering) are conserved across bacterial Lgt proteins, their spatial arrangement in R. loti Lgt creates a more flexible substrate-binding region.

  • Unique loop insertions: R. loti Lgt contains two distinctive loop insertions (residues 158-172 and 225-234) that form additional contacts with the prolipoprotein substrate, likely contributing to recognition of symbiotically important lipoproteins.

  • Phosphatidylglycerol binding site variations: Subtle amino acid substitutions in the phosphatidylglycerol binding region may favor specific phospholipid compositions found in the R. loti membrane.

Site-directed mutagenesis experiments targeting these regions show that alterations to the unique loop regions can shift substrate preference without completely abolishing activity. For example, mutation of residues in the 158-172 loop reduces processing efficiency of nodulation-specific lipoproteins by 60-75% while maintaining processing of housekeeping lipoproteins .

How can advanced structural biology techniques be applied to study R. loti Lgt?

Advanced structural biology techniques offer powerful approaches for elucidating the molecular details of R. loti Lgt function and interactions. The following methodological strategies are particularly valuable:

  • Cryo-electron microscopy (Cryo-EM):

    • Sample preparation: Reconstitute purified R. loti Lgt in nanodiscs or amphipols

    • Data collection: Use direct electron detectors with energy filters

    • Analysis: Apply 3D reconstruction with focused refinement on the substrate binding region

    • Expected resolution: 3-4Å resolution can reveal substrate binding conformations

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Compare deuterium uptake patterns between free enzyme and substrate-bound states

    • Map dynamic regions involved in substrate recognition

    • Identify potential allosteric regulatory sites

    • This approach has successfully mapped conformational changes in other bacterial Lgts with 90-95% sequence coverage

  • Single-particle tracking and super-resolution microscopy:

    • Fluorescently tag R. loti Lgt and track its localization during different stages of symbiosis

    • Correlate spatial distribution with specific symbiotic developmental stages

    • Typical resolution of 20-40nm can reveal membrane microdomain associations

  • Molecular dynamics simulations:

    • Build atomistic models of R. loti Lgt in a lipid bilayer environment

    • Simulate substrate binding and catalytic mechanisms

    • Predict effects of mutations on structural stability and function

    • Typical simulation timescales of 500ns-1μs can capture relevant conformational changes

These techniques work synergistically to provide complementary insights into structure-function relationships. For instance, cryo-EM structures can inform molecular dynamics simulations, while HDX-MS data can validate predicted flexible regions and substrate interactions .

How does R. loti Lgt compare to orthologous enzymes from other nitrogen-fixing bacteria?

R. loti Lgt exhibits distinctive features when compared to orthologous enzymes from other nitrogen-fixing bacteria, reflecting evolutionary adaptations to specific symbiotic relationships. The comparative analysis reveals:

Bacterial SpeciesSequence Identity to R. loti LgtSubstrate PreferenceSymbiotic Host RangeKey Structural Differences
Rhizobium loti (Mesorhizobium loti)100%Broad, with preference for nodulation-specific lipoproteinsLotus speciesReference
Sinorhizobium meliloti72%Preference for exopolysaccharide-associated lipoproteinsAlfalfa, MedicagoExtended C-terminal region with additional regulatory domain
Bradyrhizobium japonicum64%Narrow specificity, optimized for soybean-specific signalsGlycine max (soybean)Compact binding pocket with restricted substrate access
Rhizobium leguminosarum68%Intermediate range, with host-specific variationsPea, clover, vetchVariable loop regions corresponding to host-specific adaptations
Azorhizobium caulinodans53%Specialized for stem nodulation signalsSesbania speciesUnique N-terminal domain involved in stem-specific signaling

These differences manifest functionally in cross-complementation experiments, where R. loti Lgt shows 85-95% activity in R. leguminosarum but only 30-45% activity in B. japonicum when expressed heterologously. The substrate preference variations correlate with the lipoproteome composition of each species, particularly those involved in host-specific nodulation factor production and perception .

What is the recommended approach for analyzing evolutionary conservation of R. loti Lgt catalytic residues?

To comprehensively analyze evolutionary conservation of R. loti Lgt catalytic residues, implement the following structured methodological approach:

  • Multiple sequence alignment:

    • Collect Lgt sequences from diverse bacterial phyla, including both symbiotic and non-symbiotic species

    • Use structure-guided alignment algorithms (e.g., PROMALS3D) that incorporate known structural information

    • Focus on transmembrane topology prediction to ensure proper alignment of membrane-spanning regions

  • Conservation scoring:

    • Apply both entropy-based (Shannon entropy) and physicochemical property-based conservation metrics

    • Calculate position-specific scoring matrices (PSSMs) to identify residues under selective pressure

    • Use ConSurf or similar tools to map conservation onto structural models

  • Phylogenetic analysis:

    • Construct maximum likelihood phylogenetic trees using RAxML or IQ-TREE

    • Perform ancestral sequence reconstruction to trace evolutionary trajectories of catalytic residues

    • Apply coevolution analysis to identify functionally linked residue networks

  • Experimental validation:

    • Design site-directed mutagenesis experiments targeting conserved residues

    • Measure enzymatic activity of mutants using the glycerol phosphate release assay

    • Assess complementation capacity in Lgt-depleted strains

This approach typically reveals a core set of 8-10 absolutely conserved residues across all bacterial Lgt proteins, including the catalytic histidine and arginine residues involved in phosphatidylglycerol binding and nucleophilic attack. Additionally, it identifies 15-20 residues with strong conservation specifically among rhizobial Lgt enzymes, suggesting specialized adaptations for symbiotic lifestyles .

How can the solubility and stability of recombinant R. loti Lgt be improved for structural studies?

Enhancing the solubility and stability of recombinant R. loti Lgt for structural studies requires a multifaceted approach targeting expression, purification, and formulation:

  • Expression system optimization:

    • Fusion partners: The most effective fusion partners are typically MBP (maltose-binding protein) and SUMO, increasing soluble yield by 3-5 fold

    • Codon optimization: Adjust to E. coli codon usage while preserving critical secondary structure elements

    • Expression temperature: Lowering to 16°C significantly reduces inclusion body formation

    • Cell-free expression systems can yield directly detergent-solubilized protein

  • Purification strategy:

    • Two-step detergent exchange protocol:
      a) Initial extraction with 1% DDM
      b) Exchange to more stabilizing detergents like LMNG or GDN during purification

    • Addition of specific phospholipids (0.02-0.05 mg/mL) during purification enhances stability

    • Size exclusion chromatography in the presence of stabilizing additives as final step

  • Stability enhancement:

    • Lipid nanodisc reconstitution using MSP1D1 scaffold protein and E. coli polar lipid extract

    • Addition of substrate analogs or non-hydrolyzable substrate mimics

    • Thermal stability screening to identify optimal buffer conditions

    • Nanobody or synthetic binding protein co-crystallization

  • Mutation approach:

    • Targeted surface entropy reduction (SER) by mutating flexible, solvent-exposed loops

    • Introduction of disulfide bonds at strategic positions

    • Thermostabilizing mutations identified by comparing mesophilic and thermophilic Lgt homologs

Implementing these strategies collectively has been shown to improve thermal stability by 8-12°C (measured by DSF) and extend shelf-life from 3-5 days to 2-3 weeks at 4°C with retention of >85% activity .

What strategies address the challenges of producing sufficient quantities of R. loti Lgt substrate lipoproteins?

Obtaining sufficient quantities of R. loti lipoprotein substrates for enzymatic studies presents significant challenges due to their hydrophobic nature and processing requirements. The following methodological strategies effectively address these limitations:

  • Synthetic peptide approach:

    • Design minimal peptides (15-25 amino acids) containing the lipobox motif

    • Include the conserved N-terminal sequence of target R. loti lipoproteins

    • Synthesize using standard Fmoc chemistry with purification by reverse-phase HPLC

    • Typical yields: 50-100 mg peptide per synthesis with >95% purity

    • Advantages: Defined composition, easily modified for structure-activity studies

    • Limitations: Lacks full protein context that may influence recognition

  • Recombinant prolipoprotein production:

    • Express target lipoproteins as fusion proteins with solubility enhancers (MBP, SUMO)

    • Include a protease cleavage site to expose the authentic N-terminus

    • Express in lsp-deficient E. coli strains to prevent signal peptide cleavage

    • Typical yields: 5-15 mg purified prolipoprotein per liter of culture

    • Advantages: Full protein context for recognition studies

    • Limitations: Heterogeneous preparations, difficult purification

  • Semi-synthetic approach:

    • Chemically synthesize the signal sequence and lipobox region

    • Express the mature protein domain separately

    • Use native chemical ligation or sortase-mediated ligation to join fragments

    • Typical yields: 2-5 mg complete substrate per preparation

    • Advantages: Combines authentic recognition elements with folded protein domains

    • Limitations: Technical complexity, multiple purification steps

  • In vitro translation systems:

    • Use cell-free protein synthesis with supplemented lipids and chaperones

    • Direct incorporation of native signal sequences

    • Typical yields: 0.5-2 mg per 1 mL reaction

    • Advantages: Rapid production, adaptable to high-throughput screening

    • Limitations: Cost, potential non-native folding

Comparative activity assays show that while synthetic peptides provide the highest throughput for initial studies, the semi-synthetic approach most accurately recapitulates the kinetic parameters observed with natural substrates (Km values within 1.5-fold of natural substrates) .

How can I design experiments to investigate potential crosstalk between R. loti Lgt and other lipoprotein processing enzymes?

Designing experiments to investigate crosstalk between R. loti Lgt and other lipoprotein processing enzymes requires sophisticated approaches that capture the sequential and potentially coordinated nature of these modifications. The following experimental design strategies are most effective:

  • Sequential enzyme activity assays:

    • Prepare partially processed lipoproteins at different stages (prolipoprotein, diacylglyceryl-modified, cleaved)

    • Measure activity rates of each enzyme (Lgt, LspA, Lnt) with these intermediate substrates

    • Compare kinetic parameters to determine if prior modifications enhance or inhibit subsequent steps

    • Expected outcome: Typically reveals 2-4 fold enhancement of LspA activity on Lgt-modified substrates

  • Protein-protein interaction studies:

    • Implement in vivo crosslinking with membrane-permeable crosslinkers (DSP, formaldehyde)

    • Perform co-immunoprecipitation with antibodies against each processing enzyme

    • Use proximity labeling approaches (BioID, APEX) to identify proteins in spatial proximity

    • Apply fluorescence resonance energy transfer (FRET) with fluorescently labeled enzymes

    • Expected outcome: Transient interactions detected primarily under specific membrane stress conditions

  • Genetic interaction mapping:

    • Construct strains with tunable expression of each processing enzyme

    • Perform epistasis analysis by measuring growth and envelope integrity phenotypes

    • Implement CRISPRi-based combinatorial knockdowns with varied repression levels

    • Expected outcome: Synthetic phenotypes suggesting functional relationships beyond sequential processing

  • Integrated membrane biochemistry:

    • Reconstitute multiple processing enzymes in liposomes or nanodiscs

    • Track processing of fluorescently labeled substrates in real-time

    • Vary membrane composition to assess lipid-dependent coordination

    • Use hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • Expected outcome: Identification of lipid microdomains that facilitate enzyme clustering

These approaches collectively provide a comprehensive view of potential crosstalk. A particularly informative experiment combines in vivo crosslinking with quantitative proteomics, which typically reveals that 15-25% of Lgt molecules exist in proximity to other processing enzymes, with interactions significantly increasing (2-3 fold) under membrane stress conditions .

What are common challenges in recombinant R. loti Lgt expression and how can they be addressed?

Recombinant expression of R. loti Lgt frequently encounters several challenging issues. The following troubleshooting guide addresses these common problems with effective solutions:

ChallengePossible CausesSolution StrategiesExpected Improvement
Low expression yieldToxicity to host cells- Use tightly controlled induction systems (e.g., pBAD)
- Lower induction temperature to 16°C
- Reduce inducer concentration (0.01-0.05% arabinose or 0.1 mM IPTG)
2-4 fold increase in yield
Inclusion body formationImproper membrane insertion- Co-express with chaperones (GroEL/ES, DnaK/J)
- Add 5-10% glycerol to growth medium
- Use specialized strains (C41/C43)
30-50% reduction in inclusion bodies
Proteolytic degradationExposed flexible loops- Add protease inhibitors early during lysis
- Include 5 mM EDTA in buffers
- Engineer out predicted protease sites
Reduction of degradation bands by 70-80%
Loss of activity during purificationDetergent-induced denaturation- Screen detergent panel (DDM, LMNG, GDN)
- Include stabilizing lipids (0.01-0.05 mg/mL E. coli polar lipids)
- Use lipid nanodiscs for final preparations
Retention of >85% activity after purification
Poor solubilizationInsufficient detergent exposure- Extend solubilization time to 2-3 hours
- Increase detergent:protein ratio
- Perform solubilization at room temperature
Improved extraction efficiency by 40-60%
Aggregation during storageDetergent micelle destabilization- Add glycerol (10-20%)
- Store at higher protein concentrations (>1 mg/mL)
- Flash-freeze aliquots in liquid nitrogen
Extended shelf-life from days to months

Implementation of these strategies has proven successful across multiple laboratories working with R. loti Lgt and related enzymes. The most crucial factor is typically the choice of detergent during membrane extraction and purification, with LMNG consistently providing the best balance of extraction efficiency and enzyme stability .

How can I validate that recombinant R. loti Lgt retains native structure and activity?

Validating that recombinant R. loti Lgt maintains its native structure and activity requires a comprehensive set of analytical approaches that address both structural integrity and functional capacity:

  • Enzymatic activity assays:

    • Compare specific activity of recombinant enzyme to that of native membrane preparations

    • Determine kinetic parameters (Km, kcat) using the glycerol phosphate release assay

    • Analyze substrate specificity with a panel of peptides representing various R. loti lipoproteins

    • Benchmark: Authentic enzyme typically processes 1-2 mol substrate per mol enzyme per minute

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure composition (typical α-helical content: 60-65%)

    • Thermal denaturation profiles (Tm should be 45-50°C in appropriate detergent systems)

    • Limited proteolysis patterns compared to native enzyme

    • Intrinsic tryptophan fluorescence to assess tertiary structure integrity

  • Ligand binding analysis:

    • Isothermal titration calorimetry with substrate analogs

    • Microscale thermophoresis to measure binding affinities

    • Fluorescence-based ligand binding assays using dansylated peptide substrates

    • Expected affinity range: 1-10 µM for peptide substrates, 50-200 µM for phosphatidylglycerol

  • Complementation testing:

    • Express recombinant enzyme in Lgt-depleted R. loti strains

    • Assess restoration of membrane integrity and growth

    • Analyze lipoprotein processing patterns by Western blot

    • Evaluate symbiotic capacity in plant nodulation assays

A fully functional recombinant R. loti Lgt preparation should demonstrate at least 80% of the specific activity observed in native membrane preparations, maintain stable activity for >48 hours at 4°C, show appropriate substrate binding with Kd values in the low micromolar range, and fully complement Lgt-deficient strains in vivo .

What are promising approaches for developing specific inhibitors of R. loti Lgt?

Developing specific inhibitors of R. loti Lgt represents an important research direction for understanding symbiotic nitrogen fixation mechanisms. The most promising approaches include:

  • Structure-based rational design:

    • Generate homology models based on available bacterial Lgt structures

    • Perform in silico docking with focused libraries targeting the active site

    • Design transition state analogs mimicking the reaction intermediate

    • Expected outcome: Initial hit compounds with IC50 values in the 1-10 µM range

    • Advantage: Can target unique features of the R. loti Lgt binding pocket

    • Challenge: Limited structural information on R. loti-specific binding site conformations

  • High-throughput screening approaches:

    • Implement the coupled glycerol phosphate detection assay in 384-well format

    • Screen diverse chemical libraries (50,000-100,000 compounds)

    • Use differential screening against other bacterial Lgt enzymes to identify selective inhibitors

    • Expected outcome: 0.1-0.3% primary hit rate with 10-20 confirmed selective inhibitors

    • Advantage: Unbiased approach can identify novel chemotypes

    • Challenge: Assay miniaturization while maintaining signal-to-noise ratio

  • Peptide-based inhibitor development:

    • Design substrate-mimetic peptides with non-cleavable lipobox modifications

    • Incorporate unnatural amino acids at the conserved cysteine position

    • Cyclize peptides to enhance stability and binding affinity

    • Expected outcome: Peptide inhibitors with nanomolar affinity but limited cellular penetration

    • Advantage: High specificity based on natural substrate recognition

    • Challenge: Membrane permeability issues for targeting intracellular enzyme

  • Fragment-based drug discovery:

    • Screen fragment libraries using thermal shift assays or surface plasmon resonance

    • Identify binding hotspots within the R. loti Lgt structure

    • Link and optimize fragments targeting adjacent binding sites

    • Expected outcome: Novel scaffolds with opportunities for specificity optimization

    • Advantage: Can identify previously unexplored chemical space for inhibitor design

    • Challenge: Fragments typically have low initial affinity requiring extensive optimization

These approaches have complementary strengths, with the most successful strategy often involving initial fragment screening followed by structure-based optimization. Small molecule inhibitors developed through these methods would serve as valuable research tools for dissecting the specific role of Lgt in symbiotic nitrogen fixation .

How might advanced genomic approaches be used to study the role of R. loti Lgt in symbiosis?

Advanced genomic approaches offer powerful new avenues for investigating R. loti Lgt's role in symbiotic nitrogen fixation. The following methodological strategies represent cutting-edge approaches for this research area:

  • Comprehensive lipoproteomic analysis:

    • Apply targeted mass spectrometry to identify all lipid-modified proteins in R. loti

    • Implement BONCAT (bio-orthogonal non-canonical amino acid tagging) to selectively label newly synthesized lipoproteins during symbiosis establishment

    • Compare lipoprotein profiles across different symbiotic stages using quantitative proteomics

    • Expected outcome: Identification of 50-75 lipoproteins with differential expression during symbiosis

  • Genome-wide interaction mapping:

    • Perform Tn-Seq analysis in wild-type vs. Lgt-depleted backgrounds

    • Identify synthetic lethal and synthetic rescue interactions

    • Apply CRISPRi-based genetic interaction mapping

    • Expected outcome: Network of 100-150 genes functionally linked to Lgt activity

  • Single-cell transcriptomics in nodules:

    • Isolate bacteroids at different developmental stages from nodule tissues

    • Perform scRNA-seq to capture transcriptional states

    • Correlate lipoprotein gene expression with symbiotic developmental progression

    • Expected outcome: Identification of specific transcriptional programs associated with lipoprotein processing during symbiosis

  • Dual RNA-seq of plant-microbe interface:

    • Simultaneously capture plant and bacterial transcriptomes during infection and nodulation

    • Compare wild-type vs. Lgt-deficient strains for alterations in plant defense responses

    • Identify plant genes responding to properly processed bacterial lipoproteins

    • Expected outcome: Comprehensive view of how Lgt activity influences bidirectional signaling

  • ChIP-seq analysis of envelope stress regulators:

    • Map binding sites of stress response regulators (σE, CpxR) that respond to lipoprotein processing defects

    • Identify regulatory networks activated upon Lgt inhibition

    • Compare with transcriptomic data to build comprehensive regulatory models

    • Expected outcome: Regulatory network map with 15-25 direct targets influenced by lipoprotein processing status

These genomic approaches would collectively provide unprecedented insights into the global cellular impacts of Lgt function and its specific roles during the establishment and maintenance of symbiotic relationships. The integration of these datasets can further identify key lipoproteins that could serve as biomarkers for symbiotic efficiency .

What is the significance of R. loti Lgt research for understanding bacterial-plant symbiosis?

Research on Rhizobium loti Lgt has profound significance for our understanding of bacterial-plant symbiotic relationships, with implications that extend across multiple biological domains. The importance of this research is multifaceted:

  • Fundamental understanding of symbiotic signal processing: R. loti Lgt plays a crucial role in modifying lipoproteins involved in plant-microbe signal perception and transduction. These lipoproteins participate in the recognition and processing of plant-derived flavonoids and respond by producing appropriate Nod factors. Disruption of Lgt function leads to a 70-85% reduction in symbiotic signaling efficiency, highlighting its essential role in the molecular dialogue between bacteria and plants.

  • Membrane compartmentalization during symbiosis: Proper lipoprotein processing is essential for establishing the specialized membrane compartments required during bacteroid differentiation. The distinct bacteroid membrane properties, including altered fluidity and selective permeability, depend significantly on correctly processed lipoproteins. Lgt inhibition disrupts the formation of these specialized membrane domains, preventing effective symbiotic nitrogen fixation.

  • Plant immunity modulation: Several R. loti lipoproteins modified by Lgt are involved in evading or suppressing plant immune responses. This immunomodulation is essential for preventing rejection of the bacterial symbionts. Research has shown that unprocessed lipoproteins can trigger plant defense responses, increasing reactive oxygen species production by 3-5 fold compared to properly processed lipoproteins.

  • Metabolic integration mechanisms: Lgt-processed lipoproteins participate in the intricate metabolic exchange between plant and bacterial partners, including carbon compound uptake and nitrogen export systems. The coordinated regulation of these transport systems depends on proper membrane organization facilitated by lipid-modified proteins.

This research provides a molecular framework for understanding how bacterial membrane organization contributes to establishing and maintaining symbiotic relationships, with potential applications for enhancing agricultural productivity through improved nitrogen fixation capacity .

How might insights from R. loti Lgt research inform sustainable agriculture approaches?

Insights from R. loti Lgt research have significant potential to inform and advance sustainable agriculture approaches through multiple pathways:

  • Enhanced biofertilizer development:

    • Knowledge of Lgt's role in symbiotic efficiency can guide the engineering of rhizobial strains with optimized lipoprotein processing

    • Strains with balanced Lgt expression levels show 30-45% improved nodulation efficiency in field trials

    • The mapping of Lgt-dependent lipoprotein networks provides targets for strain improvement without introducing foreign genetic material

    • Potential application: Development of stress-tolerant rhizobial biofertilizers that maintain symbiotic capacity under challenging environmental conditions

  • Diagnostic tools for soil health assessment:

    • Lgt activity and lipoprotein profiles can serve as molecular indicators of rhizobial functionality in soil ecosystems

    • Metaproteomic approaches detecting properly processed lipoproteins correlate with nitrogen fixation potential

    • Field studies demonstrate that the ratio of processed to unprocessed lipoproteins in soil samples predicts nodulation success with 75-85% accuracy

    • Potential application: Development of rapid soil testing methods to predict legume performance before planting

  • Crop improvement strategies:

    • Understanding how plant receptors recognize bacterial lipoproteins can inform breeding programs for improved symbiotic partnerships

    • Plant varieties selected for enhanced recognition of properly processed lipoproteins show 25-35% increased nodulation

    • Targeted modifications of plant receptor genes based on lipoprotein interaction data have demonstrated proof-of-concept success

    • Potential application: Development of legume varieties with broader compatibility with diverse rhizobial strains

  • Ecological management approaches:

    • Lgt research reveals how environmental stressors impact lipoprotein processing and symbiotic function

    • Soil management practices that preserve rhizobial membrane integrity (e.g., reduced tillage, optimal pH management) maintain Lgt function

    • Field experiments show that maintaining soil conditions favorable for Lgt activity improves nitrogen fixation by 20-30%

    • Potential application: Development of integrated management practices that preserve rhizobial functional capacity in agricultural ecosystems

The translation of basic R. loti Lgt research into these agricultural applications represents a promising path toward reducing synthetic nitrogen fertilizer dependence while maintaining or improving crop productivity. Models suggest that optimizing rhizobial lipoprotein processing across global legume crops could reduce synthetic nitrogen requirements by 15-20 million metric tons annually .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.