Recombinant Rhizobium loti Putative zinc metalloprotease mll0638 (mll0638)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mll0638; Putative zinc metalloprotease mll0638
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
mll0638
Target Protein Sequence
MFLGTLVPFLFVLTVVVFVHEMGHYLVGRWCGIGVRAFSIGFGPELIGFNDRHGTRWKLC AIPLGGYVKFVGDMNATSSQPTSEELETLTDEERKVAFHTQAIWKRAATVVAGPLFNFLL TIVVFSVLFASYGRYVAEPMVAEVTADSPAAKAGIQPGDRFVSVDGSKVETFGDVQRLVS GRAGDTITFVMLRDGKEVTVTATPQLMEQQDALGNKVKVAVIGVVNNKELGQPRLITYTP VGAVAAAVEETGHVIQRTGQFLQRFAVGREDKCQLGGPVKIADMAGKAAKLGFEWLVQLV ALLSVGIGFLNLLPIPPLDGGHLLFYGVEAVIRRPVSERMMEMAYRAGLLLVLCFMGFVF WNDLFGC
Uniprot No.

Target Background

Database Links

KEGG: mlo:mll0638

STRING: 266835.mll0638

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rhizobium loti Putative zinc metalloprotease mll0638?

Recombinant Rhizobium loti Putative zinc metalloprotease mll0638 is a full-length protein (367 amino acids) from the bacterium Rhizobium loti (also known as Mesorhizobium loti), which belongs to the zinc metalloprotease family. The recombinant version is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and detection . This protein is part of the zinc-dependent protease family that plays crucial roles in various cellular processes, including extracellular matrix remodeling and protein degradation pathways .

How should mll0638 be stored and handled in laboratory settings?

For optimal stability and activity, the following storage and handling protocols are recommended:

Storage ConditionRecommendationNotes
Long-term storage-20°C/-80°CAliquoting is necessary to avoid freeze-thaw cycles
Working solution4°CFor up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0For lyophilized powder
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol (final concentration)

The protein should be briefly centrifuged prior to opening to bring contents to the bottom. Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of enzymatic activity . For experimental reproducibility, it's crucial to maintain consistent storage conditions across studies.

What are the known enzymatic activities of zinc metalloproteases like mll0638?

Zinc metalloproteases like mll0638 belong to a diverse family of enzymes characterized by their zinc-dependent proteolytic activity. Their primary function involves the hydrolysis of peptide bonds, with substrate specificity determined by their structural features. These enzymes typically contain a conserved zinc-binding motif (HEXXH) in their active site, where the zinc ion plays a critical role in catalysis .

In bacterial systems, metalloproteases often mediate various physiological processes, including:

  • Protein processing and maturation

  • Degradation of extracellular matrix components

  • Modulation of host-pathogen interactions

  • Regulation of bacterial virulence factors

  • Nutrient acquisition and metabolism

For mll0638 specifically, while it is classified as a putative zinc metalloprotease based on sequence homology, comprehensive biochemical characterization studies are still needed to definitively confirm its enzymatic properties, substrate preferences, and kinetic parameters .

How does mll0638 compare to other bacterial zinc metalloproteases?

When comparing mll0638 to other bacterial zinc metalloproteases, researchers should consider several structural and functional aspects:

Featuremll0638Other Bacterial Zinc Metalloproteases
OrganismRhizobium lotiVarious bacterial species
Size367 amino acidsTypically 300-500 amino acids
DomainsPutative zinc-binding domainOften contain additional functional domains
Cellular localizationPredicted membrane-associatedMay be secreted, membrane-bound, or cytoplasmic
RegulationLimited information availableOften regulated by environmental stimuli

While mll0638 shares the core catalytic zinc-binding domain common to metalloproteases, its specific biological role within Rhizobium loti remains to be fully characterized. Unlike extensively studied bacterial metalloproteases involved in virulence (such as those in pathogenic species), mll0638 may play specialized roles in the symbiotic lifestyle of Rhizobium, potentially in plant-bacterial interactions .

What potential roles might mll0638 play in Rhizobium-plant interactions?

Based on knowledge of related bacterial zinc metalloproteases and the ecological niche of Rhizobium loti, mll0638 might participate in several aspects of Rhizobium-plant interactions:

  • Nodulation processes: It may modify plant cell wall components to facilitate bacterial entry or nodule formation.

  • Symbiotic signaling: The protease activity could process signaling molecules involved in the establishment or maintenance of symbiosis.

  • Nutrient acquisition: It might be involved in processing complex proteins into assimilable peptides or amino acids.

  • Adaptation to the plant microenvironment: The enzyme could help Rhizobium adapt to the specific conditions within plant tissues.

  • Regulation of bacterial gene expression: Similar to other bacterial zinc-finger proteins in the Ros/MucR family, mll0638 might indirectly influence transcriptional regulation related to symbiosis genes .

Research approaches to investigate these potential roles would include creating gene knockouts, expressing the recombinant protein in heterologous systems, and conducting plant-bacteria co-culture experiments with wild-type versus mutant strains .

What are the optimal conditions for measuring enzymatic activity of recombinant mll0638?

When designing experiments to measure the enzymatic activity of recombinant mll0638, researchers should consider the following optimal conditions:

ParameterRecommended ConditionsConsiderations
Buffer system50 mM Tris-HCl, pH 7.5-8.0Zinc metalloproteases typically function optimally at slightly alkaline pH
Metal ions1-10 mM ZnCl₂Additional zinc may enhance activity; test other divalent cations (Ca²⁺, Mg²⁺)
Temperature25-37°CTest temperature range to determine optimum
Reducing agentsAvoid DTT/β-mercaptoethanolThese can chelate zinc and inhibit activity
SubstratesGeneric protease substrates (FRET-based)Begin with general metalloprotease substrates before testing specific candidates
InhibitorsEDTA, 1,10-phenanthrolineUse as negative controls to confirm metalloprotease activity

Initial activity assays should include time-course measurements to establish linear range of activity and substrate titrations to determine Km and Vmax values. Since the specific natural substrates for mll0638 are unknown, a substrate profiling approach using peptide libraries or proteomic techniques may be necessary to identify its preferred cleavage sites .

How can I design experiments to identify potential physiological substrates of mll0638?

Identifying the physiological substrates of mll0638 requires a multi-faceted experimental approach:

  • Bioinformatic prediction: Analyze the sequence of mll0638 to identify structural motifs that might indicate substrate preferences. Compare with well-characterized metalloproteases to predict potential cleavage patterns.

  • Substrate profiling using peptide libraries: Incubate the purified recombinant mll0638 with diverse peptide libraries and analyze cleavage products using mass spectrometry to establish a consensus cleavage motif.

  • Proteomic approaches:

    • Perform SILAC (Stable Isotope Labeling by Amino acids in Cell culture) experiments comparing proteomes of Rhizobium loti wild-type and mll0638 knockout strains

    • Conduct Terminal Amine Isotopic Labeling of Substrates (TAILS) to identify protein N-termini generated by mll0638 cleavage

  • In vitro validation: Once candidate substrates are identified, confirm direct cleavage using purified proteins and analyze cleavage products by SDS-PAGE and mass spectrometry.

  • In vivo confirmation: Generate mll0638 knockout or overexpression strains and examine the effects on candidate substrate levels and processing in vivo .

This comprehensive approach allows for both hypothesis-free discovery and targeted validation of physiological substrates.

What controls should be included when studying recombinant mll0638 function?

Rigorous experimental design for studying mll0638 function should include the following controls:

Control TypeSpecific ControlsPurpose
Negative controlsHeat-inactivated mll0638, Buffer onlyEstablish baseline and detect non-specific activity
Metal dependencyEDTA/EGTA treatment, Metal chelationConfirm zinc-dependency of observed activity
Specificity controlsCatalytic site mutants (e.g., HEXXH→AAXXH)Verify that observed effects require enzymatic activity
Substrate controlsNon-cleavable substrate analogsConfirm specificity of substrate recognition
Positive controlsWell-characterized zinc metalloproteasesValidate assay conditions and provide reference activity
Expression controlsWestern blot for His-tagConfirm successful expression and purification
System controlsWildtype vs. mll0638 knockout bacteriaEstablish physiological relevance in native context

Additionally, when expressing recombinant mll0638, researchers should compare the activity of protein expressed in different systems (E. coli, insect cells, etc.) to account for potential effects of post-translational modifications or folding differences . The inclusion of these controls ensures that experimental results can be attributed specifically to mll0638 activity rather than experimental artifacts.

How might structural studies of mll0638 inform its mechanism of action?

Structural characterization of mll0638 would provide critical insights into its catalytic mechanism and substrate specificity. While the full structure of mll0638 has not been reported, predictions can be made based on related zinc metalloproteases and the Ros/MucR family of zinc-finger proteins .

A comprehensive structural study of mll0638 should include:

  • X-ray crystallography or cryo-EM analysis: Determining the three-dimensional structure would reveal the spatial arrangement of the catalytic domain, substrate-binding pocket, and potential regulatory domains.

  • NMR studies: Solution NMR could identify dynamic regions and conformational changes upon substrate binding or activation, similar to approaches used for the Ros protein from Agrobacterium tumefaciens .

  • Molecular dynamics simulations: These could elucidate the protein's flexibility, metal coordination geometry, and water molecule positioning in the active site, all critical for catalytic activity.

  • Structure-function relationships: By comparing predicted structural elements with enzymatic assays of site-directed mutants, researchers could map the roles of specific residues in substrate binding, catalysis, and regulation.

The insights gained from such structural studies would facilitate rational design of inhibitors or activators and enable prediction of natural substrates based on structural complementarity .

What are the challenges in distinguishing between direct and indirect effects of mll0638 in bacterial physiology?

Determining the direct versus indirect effects of mll0638 in Rhizobium loti physiology presents several methodological challenges:

  • Pleiotropic effects: As a protease, mll0638 may have multiple substrates that affect various cellular processes, making it difficult to isolate primary from secondary effects.

  • Redundancy: Bacterial genomes often contain multiple metalloproteases with potentially overlapping functions, complicating phenotypic analysis of single gene knockouts.

  • Integration with cellular networks: Metalloproteases often function within complex regulatory networks, where perturbation of one component leads to compensatory changes in others.

  • Temporal dynamics: The effects of proteolytic activity may manifest at different time scales, from immediate proteolysis to long-term adaptations in gene expression.

To address these challenges, researchers should employ:

  • Systems biology approaches: Global transcriptomic, proteomic, and metabolomic analyses comparing wild-type and mll0638 mutant strains under various conditions.

  • Conditional expression systems: Using inducible promoters to control mll0638 expression allows temporal resolution of direct and indirect effects.

  • In vitro reconstitution: Purifying potential interacting partners and substrates to test direct interactions in a defined system.

  • Substrate trapping mutants: Engineering catalytically inactive variants that can still bind but not cleave substrates to identify direct interaction partners .

How might environmental factors regulate mll0638 expression and activity in Rhizobium loti?

Environmental regulation of mll0638 likely plays a critical role in Rhizobium loti adaptation to changing conditions, particularly during plant symbiosis. Several potential regulatory mechanisms should be investigated:

  • Transcriptional regulation: Analysis of the mll0638 promoter region may reveal binding sites for transcription factors responsive to:

    • Plant-derived signals (flavonoids, exudates)

    • Oxygen tension (important in nodule environments)

    • Nutrient availability (particularly metal ions)

    • pH changes during infection process

  • Post-translational regulation:

    • Zinc availability may directly affect enzyme activity

    • Potential inhibitory proteins (similar to TIMPs in eukaryotes)

    • Proteolytic activation (if mll0638 is produced as a zymogen)

    • Subcellular localization changes in response to environmental cues

  • Experimental approaches to examine regulation:

    • Reporter gene fusions (mll0638 promoter::GFP) to monitor expression

    • Quantitative RT-PCR under various environmental conditions

    • Chromatin immunoprecipitation to identify transcriptional regulators

    • Protein stability and turnover studies using pulse-chase experiments

  • Integration with symbiosis signaling:

    • Examine how mll0638 expression changes during different stages of nodulation

    • Test if plant defense responses affect mll0638 regulation

    • Investigate potential cross-talk with other symbiosis genes

Understanding these regulatory mechanisms would provide insights into how mll0638 function is coordinated with other cellular processes during the complex Rhizobium-plant interaction .

What are the best approaches for reconstituting lyophilized mll0638 protein to maintain optimal activity?

Proper reconstitution of lyophilized mll0638 is critical for preserving its enzymatic activity. The following methodological recommendations ensure optimal protein functionality:

  • Pre-reconstitution preparation:

    • Equilibrate the lyophilized protein to room temperature before opening to prevent condensation

    • Briefly centrifuge the vial to collect all material at the bottom

    • Work in a clean environment to prevent contamination

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • Gently mix by rotating or inverting the vial rather than vortexing

    • Allow 5-10 minutes for complete dissolution

    • For long-term storage, add glycerol to a final concentration of 50%

  • Post-reconstitution handling:

    • Prepare small working aliquots to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • For extended storage, keep at -20°C/-80°C

  • Quality control:

    • Verify protein concentration using Bradford or BCA assay

    • Confirm purity by SDS-PAGE

    • Test enzymatic activity using a standard substrate before experimental use

Following these protocols will help maintain the structural integrity and catalytic activity of the recombinant mll0638 protein.

What experimental strategies can address the challenges of working with membrane-associated metalloproteases?

Based on its amino acid sequence containing hydrophobic regions, mll0638 may be membrane-associated, presenting specific experimental challenges. Researchers should consider the following strategies:

  • Protein extraction and purification:

    • Use mild detergents (CHAPS, DDM, or Triton X-100) for initial solubilization

    • Consider membrane fractionation techniques to isolate native protein

    • Test detergent screening panels to identify optimal solubilization conditions

    • Employ amphipols or nanodiscs for maintaining native-like membrane environment

  • Activity assays:

    • Design assays compatible with detergent presence

    • Consider solid-phase assays where the substrate is immobilized

    • Use fluorogenic substrates with high sensitivity to detect low activity levels

    • Include appropriate controls to account for detergent effects on substrates

  • Structural studies:

    • Lipidomic analysis to identify associated lipids that may affect function

    • Employ cryo-EM rather than crystallography for membrane proteins

    • Consider hydrogen-deuterium exchange mass spectrometry for dynamics

    • Use molecular dynamics simulations to model membrane interactions

  • In vivo studies:

    • Develop membrane-targeted fluorescent tags to monitor localization

    • Use split-complementation assays to detect membrane-localized interactions

    • Design cell fractionation protocols to preserve native membrane associations

These approaches help overcome the inherent difficulties of studying membrane-associated enzymes while preserving their functional properties.

How can researchers develop specific assays to measure mll0638 activity in complex biological samples?

Developing specific assays for mll0638 activity in complex samples such as bacterial lysates or plant-bacteria co-cultures requires strategies to distinguish its activity from other proteases:

  • Substrate-based approaches:

    • Design peptide substrates with specificity for mll0638 based on:

      • Sequence alignments with related metalloproteases

      • Results from substrate profiling experiments

      • Structural predictions of the substrate-binding pocket

    • Incorporate reporter groups (fluorophore/quencher pairs) for sensitive detection

    • Validate specificity using recombinant mll0638 versus control proteases

  • Inhibitor-based approaches:

    • Develop a cocktail of inhibitors targeting other protease classes (serine, cysteine, aspartic proteases)

    • Use zinc chelators as negative controls to specifically inhibit mll0638

    • Consider developing specific antibodies against mll0638 for immunodepletion controls

  • Genetic approaches for validation:

    • Compare activity in wild-type versus mll0638 knockout samples

    • Complement knockout with wild-type or catalytically inactive mutants

    • Use inducible expression systems to correlate activity with mll0638 levels

  • Advanced detection methods:

    • Activity-based protein profiling using metalloprotease-specific probes

    • Mass spectrometry to identify mll0638-specific cleavage products

    • Zymography under conditions optimized for metalloprotease activity

  • Data analysis considerations:

    • Implement kinetic analysis to distinguish enzyme activities based on reaction rates

    • Use multivariate statistical methods to deconvolute complex activity profiles

    • Develop computational models to predict contributions of different proteases

These methodological approaches enable specific measurement of mll0638 activity even in the presence of other proteolytic enzymes.

What are promising research directions for understanding mll0638's role in bacterial-plant symbiosis?

Future research on mll0638's role in Rhizobium-plant symbiosis should explore several promising directions:

  • Symbiotic signaling networks:

    • Investigate whether mll0638 processes nodulation factors or plant recognition signals

    • Examine its potential role in modifying plant defense responses during nodule formation

    • Study how mll0638 activity changes throughout the stages of symbiosis establishment

  • Comparative studies across Rhizobium species:

    • Analyze conservation and divergence of mll0638 homologs across symbiotic bacteria

    • Correlate sequence variations with host plant specificity

    • Perform cross-complementation studies between different species

  • Integration with other bacterial zinc-finger proteins:

    • Explore potential functional relationships with the Ros/MucR family proteins

    • Investigate whether mll0638 participates in gene silencing mechanisms similar to H-NS-like proteins

    • Examine potential roles in regulating cell cycle or virulence genes

  • Plant-bacterial interface studies:

    • Develop in situ activity assays to monitor mll0638 function at the plant-bacterial interface

    • Use advanced microscopy techniques to track mll0638 localization during infection

    • Identify plant proteins that interact with or are processed by mll0638

  • Potential biotechnological applications:

    • Explore whether modulating mll0638 activity can enhance nitrogen fixation efficiency

    • Investigate its potential as a target for improving crop-Rhizobium associations

    • Develop tools based on mll0638 for studying plant-microbe interactions

These research directions would significantly advance our understanding of the molecular mechanisms underlying successful symbiotic relationships between rhizobia and leguminous plants .

How might cross-disciplinary approaches enhance our understanding of mll0638 function?

Integrating multiple scientific disciplines would substantially enhance our understanding of mll0638 function:

  • Structural biology and computational approaches:

    • Apply molecular dynamics simulations to predict substrate binding and catalytic mechanisms

    • Use homology modeling and AI-based structure prediction (AlphaFold) to generate structural models

    • Employ virtual screening to identify potential inhibitors or activators

  • Systems biology and network analysis:

    • Map the position of mll0638 within global protein interaction networks

    • Use metabolic flux analysis to identify pathways affected by mll0638 activity

    • Develop mathematical models of metalloprotease regulation in bacterial systems

  • Advanced imaging techniques:

    • Apply super-resolution microscopy to track mll0638 localization during infection

    • Use FRET-based biosensors to monitor mll0638 activity in real-time

    • Implement correlative light and electron microscopy to study its ultrastructural context

  • Synthetic biology approaches:

    • Engineer mll0638 variants with altered specificity or activity

    • Create synthetic circuits to control mll0638 expression in response to defined signals

    • Design reporter systems to monitor mll0638-dependent processes

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models

    • Apply machine learning to identify patterns associated with mll0638 function

    • Use network analysis to predict indirect effects of mll0638 perturbation

These cross-disciplinary approaches would provide a more comprehensive understanding of mll0638's biological functions and potential applications in agricultural and biotechnological contexts .

What technological innovations might facilitate better characterization of metalloproteases like mll0638?

Emerging technologies that could revolutionize the study of metalloproteases like mll0638 include:

  • Advanced protein engineering tools:

    • CRISPR-Cas9 based precise genome editing for studying mll0638 in its native context

    • Expanded genetic code incorporation to introduce non-canonical amino acids for mechanistic studies

    • Protein semi-synthesis approaches to create chimeric metalloproteases for function analysis

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational changes during catalysis

    • Optical tweezers to measure forces involved in substrate processing

    • Nanopore-based detection of metalloprotease activity with single-enzyme resolution

  • Advanced mass spectrometry methods:

    • Top-down proteomics to characterize intact mll0638 and its post-translational modifications

    • Ion mobility mass spectrometry to study conformational dynamics

    • Crosslinking mass spectrometry to map interaction interfaces with substrates and partners

  • Microfluidic and high-throughput screening platforms:

    • Droplet microfluidics for massively parallel activity assays

    • Cell-free expression systems for rapid variant testing

    • Automated substrate profiling using synthetic peptide libraries

  • Integrative structural biology approaches:

    • Time-resolved crystallography to capture catalytic intermediates

    • Cryo-electron tomography to visualize mll0638 in its native bacterial membrane context

    • Neutron diffraction to precisely locate hydrogen atoms in the catalytic mechanism

These technological innovations would provide unprecedented insights into the structural dynamics, catalytic mechanisms, and biological functions of metalloproteases like mll0638, potentially leading to novel applications in biotechnology and agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.