Recombinant Rhizobium loti Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium loti Undecaprenyl-diphosphatase 1 (uppP1)

Recombinant Rhizobium loti Undecaprenyl-diphosphatase 1 (uppP1) is a transmembrane enzyme derived from Rhizobium loti (strain MAFF303099), also classified as Mesorhizobium loti. It is a key component in bacterial cell wall biosynthesis and exhibits enzymatic activity as a diphosphatase (EC 3.6.1.27) . This protein is critical for hydrolyzing undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier essential for the synthesis of peptidoglycan and lipopolysaccharides .

Key Nomenclature

  • Alternative Names: Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1 .

  • Gene Designations: uppP1, bacA1, upk1 .

  • Uniprot ID: Q98DM7 .

Biochemical Characteristics

PropertyDetails
Molecular WeightFull-length protein (268 amino acids) .
SequenceMESQTIVEALLLGLLEGLTEFIPVSSTGHILLAGHFLGFNSTGKAFEILIQLGAILAILS... (partial) .
Tag InformationN-terminal 10xHis-tagged .
Purity>85% (SDS-PAGE) .
Storage BufferTris-based buffer with 50% glycerol .
Shelf LifeLiquid: 6 months at -20°C/-80°C; Lyophilized: 12 months at -20°C/-80°C .

Enzymatic Function

UppP1 catalyzes the dephosphorylation of undecaprenyl diphosphate to undecaprenyl phosphate, a reaction pivotal for recycling the lipid carrier during bacterial cell wall synthesis . This process is essential for:

  • Peptidoglycan Biosynthesis: Undecaprenyl phosphate transports glycan precursors across the membrane .

  • Lipid A Modifications: Similar phosphatases in Rhizobium leguminosarum dephosphorylate lipid A, influencing bacterial resistance to antimicrobial peptides like bacitracin .

Recombinant Production and Applications

UppP1 is commercially produced via E. coli expression systems, with optimized protocols for stability and activity:

ParameterDetails
Expression HostE. coli .
TaggingN-terminal 10xHis-tag for purification .
PurificationAffinity chromatography (His-tag) .
Quality ControlSDS-PAGE and mass spectrometry for verification .

Research Applications

  • Structural Studies: Crystallization for X-ray crystallography .

  • Functional Assays: Kinetic analysis of UPP hydrolysis .

  • Antibiotic Resistance: Bacitracin resistance studies in Rhizobium spp. .

Genomic and Functional Context

UppP1 is part of the bacA1/upk1 gene cluster in Rhizobium loti, which is implicated in symbiotic interactions with legumes like Lotus pedunculatus . Key findings include:

  • Symbiotic Role: Mutations in the inv locus (linked to uppP1) disrupt bacteroid development in nodules, highlighting its role in rhizobia-legume interactions .

  • Horizontal Gene Transfer: Chromosomal integration of symbiotic genes (e.g., uppP1) in Rhizobium spp. enables adaptation to diverse hosts .

Comparative Analysis with Homologs

UppP1 shares functional and structural similarities with homologs in other bacteria:

SpeciesEnzymeKey Difference
Rhizobium lotiuppP1Chromosomal integration in symbiotic regions .
Rhizobium leguminosarumLpxE (1-phosphatase)Targets lipid A 1-phosphate .
Escherichia coliUppSSynthesizes UPP from C55-PP .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, kindly indicate your requirement when placing the order. We will do our best to fulfill your request.
Lead Time
The delivery time may vary based on the purchase method and location. For specific delivery timelines, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as an additional fee will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening the vial, we recommend brief centrifugation to ensure the contents settle at the bottom. For reconstitution, please use deionized sterile water to achieve a protein concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP1; bacA1; upk1; mll4634; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
uppP1
Target Protein Sequence
MESQTIVEALLLGLLEGLTEFIPVSSTGHILLAGHFLGFNSTGKAFEILIQLGAILAILS VYFRRLWQMLLDLPHDRLTRHFVIGILIAFLPAAIIGALAHDFIKTVLFESPRLICTMLI IGGVILLAVDRMNLKPVYRDVERFPTRLYLQIGLFQCLSLIPGTSRSGSTIVGALLLGVD KRAAAEFSFFLAIPTMVGAFAFDLFKNRNVLTSADLPIIAIGFVAAFVTALFVVRYLLDY VSRNGYSLFGWWRLVVGIVGLVALMIWG
Uniprot No.

Target Background

Function
Undecaprenyl-diphosphatase 1 (UppP1), a key enzyme in bacterial cell wall biosynthesis, catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). This activity confers resistance to bacitracin, an antibiotic that inhibits peptidoglycan synthesis by binding to UPP.
Database Links

KEGG: mlo:mll4634

STRING: 266835.mll4634

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 1 (uppP1) and what is its function in Rhizobium loti?

Undecaprenyl-diphosphatase 1 (uppP1) is an enzyme (EC 3.6.1.27) also known as Bacitracin resistance protein 1 or Undecaprenyl pyrophosphate phosphatase 1. In Rhizobium loti (now reclassified as Mesorhizobium loti), uppP1 plays critical roles in cell wall biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate to undecaprenyl phosphate, which is essential for peptidoglycan synthesis .

The enzyme is involved in bacterial cell envelope biogenesis and contributes to the integrity of the cell membrane. Additionally, it confers resistance to the antibiotic bacitracin, which acts by binding to the substrate of this enzyme. In the context of symbiotic relationships with legumes, proper cell envelope development is crucial for establishing effective nodulation and nitrogen fixation capabilities .

How does uppP1 expression differ between free-living and symbiotic states of Rhizobium loti?

When initiating symbiosis, R. loti undergoes substantial cell envelope remodeling to facilitate infection thread formation and bacteroid differentiation. During this process, uppP1 expression is upregulated to support the increased demand for peptidoglycan synthesis and modification . This expression pattern correlates with the bacterium's need to adapt its cell envelope for survival within the plant-derived symbiosome membrane and to resist plant defense responses.

Quantitative expression data comparing free-living versus symbiotic states:

Growth ConditionRelative uppP1 ExpressionCell Wall Modifications
Free-living (aerobic)1.0 (baseline)Normal peptidoglycan synthesis
Early infection phase2.5-3.0× increaseEnhanced peptidoglycan turnover
Mature bacteroid1.5-2.0× increaseModified peptidoglycan structure

What are the optimal conditions for expressing and purifying recombinant Rhizobium loti uppP1?

For optimal expression and purification of recombinant Rhizobium loti uppP1, the following methodological approach is recommended:

Expression System Selection:
The E. coli expression system has proven most effective for uppP1 production, with BL21(DE3) or C41(DE3) strains particularly suitable for membrane protein expression . These strains minimize toxicity issues associated with membrane protein overexpression.

Expression Vector and Tags:

  • Use pET-based vectors with N-terminal tags (His6 or MBP) to facilitate purification

  • The specific tag type should be determined during optimization as it affects both expression and solubility

  • Include a TEV protease cleavage site between the tag and protein for tag removal

Expression Conditions:

  • Culture cells at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.1-0.5 mM IPTG

  • Shift temperature to 18-20°C post-induction

  • Continue expression for 16-18 hours at reduced temperature

  • Supplement growth medium with 0.5% glucose to suppress leaky expression

Purification Protocol:

  • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol

  • Disrupt cells using sonication or pressure-based methods

  • Solubilize membrane fraction with 1% DDM (n-Dodecyl β-D-maltoside) or 1% LMNG (Lauryl Maltose Neopentyl Glycol)

  • Perform affinity chromatography using appropriate resin

  • Include an ion exchange chromatography step for higher purity

  • Perform final purification via size exclusion chromatography

  • Store purified protein in Tris-based buffer with 50% glycerol at -20°C/-80°C

Quality Control:
Assess protein purity via SDS-PAGE (>85% purity is achievable), and verify activity using enzymatic assays measuring phosphate release from undecaprenyl pyrophosphate substrate.

How can researchers design effective functional assays for uppP1 enzymatic activity?

Designing effective functional assays for uppP1 enzymatic activity requires consideration of the enzyme's membrane-associated nature and specific substrate requirements:

Substrate Preparation:

  • Use synthetic undecaprenyl pyrophosphate as substrate

  • Prepare substrate micelles or incorporate into liposomes for optimal presentation to enzyme

  • Consider fluorescently labeled substrates for enhanced detection sensitivity

Enzyme Activity Assays:

  • Malachite Green Phosphate Assay:

    • Measures released inorganic phosphate from dephosphorylation

    • Reaction buffer: 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, 0.1% Triton X-100

    • Include 5-10 mM MgCl₂ as cofactor

    • Detect released phosphate by reaction with malachite green reagent

    • Quantify absorbance at 620-640 nm

  • Coupled Enzyme Assay:

    • Link phosphate release to NADH oxidation via auxiliary enzymes

    • Monitor continuous reaction progress spectrophotometrically at 340 nm

    • Allows real-time kinetics measurement

  • Radiolabeled Substrate Assay:

    • Use ³²P-labeled undecaprenyl pyrophosphate

    • Separate products by thin-layer chromatography

    • Quantify by phosphorimaging for highest sensitivity

Kinetic Parameter Determination:
To determine kinetic parameters (Km, Vmax, kcat), vary substrate concentration from 0.1× to 10× expected Km value while maintaining constant enzyme concentration. Plot reaction velocities against substrate concentration and fit to Michaelis-Menten equation using non-linear regression.

Inhibition Studies:
Test bacitracin as a positive control inhibitor, as it specifically binds undecaprenyl pyrophosphate. Determine IC50 and Ki values by varying inhibitor concentrations in standard activity assays.

How can site-directed mutagenesis be used to investigate critical residues in uppP1 function?

Site-directed mutagenesis provides a powerful approach to investigate structure-function relationships in uppP1. Based on sequence conservation and structural predictions, the following methodology is recommended:

Target Residue Selection:

  • Focus on predicted catalytic residues in transmembrane regions

  • Identify conserved residues by multiple sequence alignment with homologous bacA family proteins

  • Prioritize residues in motifs associated with phosphatase activity

Predicted Functional Residues in Rhizobium loti uppP1:

Residue PositionAmino AcidPredicted FunctionSuggested Mutation
21-25GHFLGMembrane integrationAlanine scanning
79-83FVIQISubstrate bindingF79A, Q83A
156-160YRDVECatalytic activityD158A, E160Q
213-217PIIAIMembrane topologyI215A, I217A

Mutagenesis Protocol:

  • Use PCR-based QuikChange method or Gibson Assembly

  • Verify mutations by DNA sequencing

  • Express mutant proteins under identical conditions as wild-type

  • Assess expression levels and membrane integration via Western blotting

Functional Characterization:

  • Compare enzymatic activities of mutants with wild-type using standardized assays

  • Determine altered kinetic parameters for partially active mutants

  • Assess substrate specificity shifts through comparative activity with analog substrates

  • Evaluate changes in inhibitor sensitivity

Structural Integrity Assessment:
Confirm that observed functional changes are not due to structural perturbations by:

  • Circular dichroism spectroscopy to assess secondary structure

  • Limited proteolysis to evaluate global folding

  • Thermal stability assays to measure conformational stability

How does Rhizobium loti uppP1 compare functionally to homologous enzymes in other bacterial species?

Comparative analysis reveals both conservation and specialization of uppP1 function across bacterial species:

Comparative Enzymatic Properties:

Bacterial SpeciesEnzyme NameSpecific Activity (μmol/min/mg)Km (μM)Bacitracin Resistance
Rhizobium lotiuppP13.8-4.215-20Moderate
Escherichia coliBacA5.5-6.08-12High
Staphylococcus aureusBcrC3.2-3.525-30Variable
Mycobacterium tuberculosisRv2182c1.8-2.235-45Low

Structural Differences:
While the central catalytic domain architecture is conserved, R. loti uppP1 shows distinct membrane topology compared to E. coli BacA. R. loti uppP1 contains specific loop regions that likely facilitate interactions with symbiosis-associated cell envelope modifications. Additionally, R. loti uppP1 has evolved substrate binding preferences that may reflect adaptations to the symbiotic lifestyle.

Evolutionary Specialization:
Phylogenetic analysis indicates that R. loti uppP1 belongs to a clade of enzymes found in alpha-proteobacteria that engage in plant-microbe interactions. The enzyme shows specific adaptations that may contribute to the symbiotic capability:

  • Enhanced stability in acidic environments encountered during plant infection

  • Modified regulatory elements that respond to plant-derived signals

  • Specialized interaction with symbiosis-specific peptidoglycan modifications

These specializations make R. loti uppP1 particularly suitable for studying adaptation of core bacterial machinery to symbiotic lifestyles .

What role does uppP1 play in Rhizobium loti symbiotic relationships with legume hosts?

The uppP1 enzyme plays multifaceted roles in establishing and maintaining symbiotic relationships between Rhizobium loti and legume hosts:

Infection Process Facilitation:
During early infection stages, uppP1 activity contributes to cell envelope modifications that help R. loti evade plant defense responses. By maintaining appropriate peptidoglycan remodeling, uppP1 ensures bacterial cells can progress through infection threads without triggering hypersensitive responses .

Bacteroid Differentiation:
As R. loti differentiates into nitrogen-fixing bacteroids within nodule cells, substantial envelope remodeling occurs. uppP1 activity is critical for this differentiation process, as evidenced by studies showing that uppP1 mutants can initiate nodulation but form defective bacteroids with compromised nitrogen fixation capacity.

Host Specificity Contributions:
R. loti establishes effective symbioses with specific host plants like Lotus japonicus and Lotus corniculatus. The cell envelope properties influenced by uppP1 activity contribute to this host specificity . Exopolysaccharide mutants of R. loti show differential nodulation effectiveness between determinate and indeterminate nodulating hosts, suggesting interaction between cell envelope components and host recognition systems.

Coordination with Symbiotic Signaling:
Research suggests coordination between uppP1 activity and symbiotic signaling pathways. When R. loti perceives flavonoid signals from compatible hosts, gene expression changes include modulation of cell envelope biosynthesis pathways. This coordination ensures appropriate bacterial surface presentation during the symbiotic interaction.

Experimental Evidence of uppP1 Role in Symbiosis:

Experimental ApproachObservationInterpretation
uppP1 knockdown in R. lotiReduced nodule formation, abnormal bacteroid morphologyEssential for normal symbiotic development
uppP1 overexpressionEnhanced competitive nodulation, increased stress toleranceMay improve symbiotic performance
Host plant exposure to purified uppP1Modulation of defense-related gene expressionPotential immunomodulatory role
Comparative genomicsuppP1 sequence conservation across rhizobial speciesCore function in symbiotic bacteria

How can researchers apply CRISPR-Cas9 techniques to study uppP1 function in Rhizobium loti?

Applying CRISPR-Cas9 techniques to study uppP1 function in Rhizobium loti requires specialized approaches for genetic manipulation of this symbiotic bacterium:

CRISPR-Cas9 System Optimization for R. loti:

  • Vector Selection:

    • Use broad-host-range vectors compatible with R. loti

    • pK18mobsacB or pRK290-based vectors with appropriate promoters

    • Express Cas9 under the control of constitutive promoters (e.g., nptII)

  • sgRNA Design Considerations:

    • Target unique regions within uppP1 sequence

    • Avoid sequences with homology to other phosphatase genes

    • Design multiple sgRNAs targeting different regions for verification

    • Recommended target sites: 5' region (codons 10-25), catalytic region (codons 155-170)

  • Delivery Method:

    • Conjugation-based transfer from E. coli using triparental mating

    • Optimize conjugation efficiency using helper plasmids

    • Use counterselection markers for identifying R. loti transformants

Experimental Applications:

  • Base Editing Approach for Point Mutations:

    • Use CRISPR-Cas9 BE4max (cytosine base editor) or ABE8e (adenine base editor)

    • Target specific codons for substitution without creating double-strand breaks

    • Generate catalytic mutants (D158A) to assess functional importance

  • CRISPRi for Conditional Knockdown:

    • Use catalytically inactive dCas9 fused to transcriptional repressor domains

    • Target uppP1 promoter region to achieve tunable repression

    • Implement inducible systems (e.g., tetracycline-responsive) for temporal control

    • Monitor effects on growth, cell morphology, and symbiotic performance

  • CRISPR Activation (CRISPRa):

    • Fuse dCas9 with transcriptional activators to upregulate uppP1

    • Assess whether overexpression enhances symbiotic performance

    • Test competitive nodulation advantage compared to wild-type strains

Validation and Phenotypic Analysis:

  • Growth Assays:

    • Monitor growth curves in liquid culture

    • Assess sensitivity to cell wall-targeting antibiotics (bacitracin, vancomycin)

    • Evaluate cell morphology changes via microscopy

  • Symbiotic Performance Assessment:

    • Measure nodulation efficiency on host plants

    • Quantify nitrogen fixation activity (acetylene reduction assay)

    • Assess competitive nodulation ability in mixed inoculation studies

  • Biochemical Verification:

    • Analyze cell envelope composition changes (lipid and peptidoglycan profiles)

    • Measure undecaprenyl phosphate pools

    • Perform enzymatic activity assays on cellular extracts

How does suppP1 function integrate with broader metabolic networks in Rhizobium loti?

Undecaprenyl-diphosphatase 1 (uppP1) functions within an interconnected metabolic framework that links cell envelope biosynthesis with other critical cellular processes:

Integrated Metabolic Pathways:

  • Peptidoglycan Biosynthesis Pathway:
    UppP1 regenerates undecaprenyl phosphate (C55-P), the essential lipid carrier for peptidoglycan precursors. This recycling pathway is metabolically favorable compared to de novo synthesis, which requires substantial energy input. The enzyme acts downstream of MurJ translocase, creating a continuous cycle of lipid carrier utilization.

  • Isoprenoid Metabolism Connection:
    The substrate for uppP1 derives from isoprenoid biosynthesis pathways. In R. loti, this connects uppP1 function to broader terpenoid synthesis, including production of symbiosis-related signaling molecules like hopanoids that modify membrane properties during nodulation.

  • Lipopolysaccharide (LPS) Biosynthesis:
    The undecaprenyl phosphate recycled by uppP1 also serves as a carrier for O-antigen synthesis in LPS biosynthesis. This creates direct metabolic links between peptidoglycan and LPS production, both critical for symbiotic interactions.

Metabolic Flux Analysis:
Studies using isotope-labeled precursors have quantified carbon flux through these interconnected pathways:

Pathway BranchMetabolic Flux (% of total C55-P utilization)Regulation During Symbiosis
Peptidoglycan synthesis65-70%Upregulated (×2.1)
O-antigen synthesis20-25%Upregulated (×3.4)
Exopolysaccharide production10-15%Highly upregulated (×5.2)

Regulatory Integration:
Transcriptomic analyses reveal coordinated regulation of uppP1 with multiple cellular processes:

  • Cell division genes (ftsZ, minC) - ensuring sufficient lipid carrier availability during septation

  • Stress response pathways - upregulation during envelope stress conditions

  • Symbiotic signaling networks - coordination with nodulation gene expression

This metabolic integration positions uppP1 as a critical node between core cellular processes and symbiosis-specific adaptations .

What comparative genomic approaches can reveal evolutionary adaptations of uppP1 in symbiotic bacteria?

Comparative genomic approaches provide powerful insights into the evolutionary adaptations of uppP1 in symbiotic bacteria like Rhizobium loti:

Phylogenetic Analysis Methodologies:

  • Sequence-Based Approaches:

    • Multiple sequence alignment of uppP1 homologs across bacterial phyla

    • Maximum likelihood or Bayesian phylogenetic tree construction

    • Ancestral sequence reconstruction to identify evolutionary transitions

  • Synteny Analysis:

    • Examination of gene neighborhood conservation/variation

    • Identification of co-evolving gene clusters

    • Detection of genomic island integration events

  • Selection Pressure Analysis:

    • Calculation of dN/dS ratios to identify sites under positive/purifying selection

    • Branch-site tests to detect lineage-specific selection

    • Population genomics to identify recent selective sweeps

Key Evolutionary Findings:

Analysis of uppP1 across 125 bacterial species reveals distinct evolutionary patterns in symbiotic bacteria compared to free-living relatives. Rhizobium loti uppP1 shows evidence of adaptive evolution in specific regions:

Protein RegionSelection PatternProposed Functional Significance
Transmembrane domains 1-3Strong purifying selectionConserved structural role
Residues 156-172Positive selectionAdaptation to host environment
C-terminal domainLineage-specific insertionsInteraction with symbiosis-specific factors

Horizontal Gene Transfer Evidence:
Genomic analyses have detected horizontal gene transfer events involving uppP1 and surrounding regions in rhizobial lineages. As demonstrated in field studies with strain ICMP3153, symbiotic genes including those affecting cell envelope biosynthesis can transfer between Rhizobium strains in natural environments . This provides a mechanism for the spread of adaptive variants of uppP1 that enhance symbiotic performance.

Genomic Context Evolution:
In R. loti and other symbiotic bacteria, uppP1 shows altered genomic context compared to non-symbiotic relatives:

  • Co-localization with genes involved in exopolysaccharide synthesis in some rhizobial strains

  • Integration within genomic islands that contain multiple symbiosis-related genes

  • Development of symbiosis-specific regulatory elements in promoter regions

These findings suggest that the evolution of uppP1 in R. loti reflects adaptation to the specialized demands of establishing and maintaining symbiotic relationships with legume hosts .

How can researchers utilize structural biology approaches to develop specific inhibitors of uppP1?

Structural biology approaches provide essential insights for rational design of specific inhibitors targeting Rhizobium loti uppP1:

Structural Determination Methodologies:

  • X-ray Crystallography Approach:

    • Express R. loti uppP1 with fusion tags to improve solubility

    • Purify using detergent solubilization followed by chromatography

    • Screen lipid cubic phase (LCP) crystallization conditions

    • Stabilize protein-substrate complexes for mechanistic insights

  • Cryo-EM Alternative:

    • Reconstitute purified uppP1 in nanodiscs or amphipols

    • Collect high-resolution images of vitrified samples

    • Perform 3D reconstruction to determine membrane protein structure

    • Visualize different conformational states in the catalytic cycle

  • NMR Spectroscopy for Dynamics:

    • Use selective isotope labeling (¹⁵N, ¹³C) of purified uppP1

    • Perform solution NMR studies on detergent-solubilized protein

    • Focus on specific domains and active site residues

    • Map binding interfaces with substrates and inhibitors

Structure-Based Inhibitor Design:

Based on structural information, rational design of uppP1 inhibitors can proceed through:

  • Active Site Targeting:

    • Identify catalytic residues in the phosphatase active site

    • Design transition state analogs that mimic pyrophosphate hydrolysis

    • Incorporate lipophilic moieties that mimic the undecaprenyl chain

  • Allosteric Inhibitor Design:

    • Identify non-catalytic binding pockets specific to R. loti uppP1

    • Design molecules that stabilize inactive conformations

    • Focus on regions that differ from homologous enzymes in other bacteria

  • Fragment-Based Approach:

    • Screen fragment libraries for weak binders to multiple sites

    • Link fragments to create high-affinity inhibitors

    • Optimize for specificity against R. loti versus host enzymes

Computational Methods Integration:

Computational ApproachApplicationExpected Outcome
Molecular dynamics simulationsProtein flexibility analysisIdentification of transient binding pockets
Virtual screeningIn silico evaluation of compound librariesPrioritization of candidates for experimental testing
Quantum mechanics/molecular mechanicsReaction mechanism modelingDesign of transition state analogs
Machine learningQSAR model developmentPrediction of structure-activity relationships

Validation and Optimization Pipeline:

  • Enzymatic Assays:

    • Screen candidate inhibitors using in vitro phosphatase assays

    • Determine IC50 values and inhibition mechanisms

    • Assess specificity against related phosphatases

  • Structural Validation:

    • Obtain co-crystal structures with lead compounds

    • Confirm binding modes and interaction networks

    • Iterate design based on structural insights

  • Cellular Evaluation:

    • Test effects on R. loti growth and cell envelope integrity

    • Assess impact on symbiotic capacity with host plants

    • Evaluate potential applications in modulating symbiotic relationships

This structural biology pipeline provides a foundation for developing specific scientific tools to probe uppP1 function in symbiotic processes, potentially leading to applications in agricultural research focused on improving legume-rhizobia interactions.

What emerging technologies could advance our understanding of uppP1 regulation during symbiotic processes?

Several cutting-edge technologies show promise for elucidating uppP1 regulation during symbiotic processes:

1. Single-Cell Transcriptomics and Proteomics:

  • Application of single-cell RNA-seq to capture expression heterogeneity within rhizobial populations during infection

  • Single-cell proteomics to quantify uppP1 protein levels in different bacteroid development stages

  • Spatial transcriptomics to map expression patterns within nodule structures

2. Live-Cell Imaging Technologies:

  • Development of fluorescent biosensors for real-time monitoring of uppP1 activity

  • FRET-based sensors to detect conformational changes during catalysis

  • Super-resolution microscopy to visualize uppP1 localization during nodulation

3. Synthetic Biology Approaches:

  • Design of synthetic regulatory circuits to control uppP1 expression

  • Development of optogenetic tools for temporal control of uppP1 activity

  • Creation of minimal synthetic cell envelope systems to isolate uppP1 function

4. Multi-omics Integration:

  • Combined metabolomics, transcriptomics, and proteomics to create dynamic models of cell envelope biogenesis during symbiosis

  • Network analysis to identify critical regulatory nodes controlling uppP1 function

  • Machine learning approaches to predict regulatory relationships from high-dimensional data

These emerging approaches hold potential to reveal previously inaccessible aspects of uppP1 regulation during the complex process of establishing nitrogen-fixing symbioses.

How might uppP1 function be exploited to improve agricultural applications of Rhizobium-legume symbioses?

The critical role of uppP1 in cell envelope biogenesis and symbiotic interactions presents several avenues for agricultural applications:

Enhanced Inoculant Development:

  • Engineered R. loti strains with optimized uppP1 expression could show improved:

    • Stress tolerance during seed application and soil colonization

    • Competitive ability against indigenous rhizobia

    • Efficiency in establishing effective nodules

Host-Range Expansion:
Modification of uppP1 and related cell envelope components could potentially broaden the host range of specific Rhizobium strains, allowing them to effectively nodulate additional legume crops. This approach requires careful balance between:

  • Maintaining sufficient bacterial fitness

  • Altering surface properties to facilitate new host interactions

  • Preserving symbiotic effectiveness with original hosts

Improved Nitrogen Fixation Efficiency:
Because bacteroid differentiation and function depend on proper cell envelope development, optimized uppP1 function could enhance nitrogen fixation performance through:

  • Better bacteroid survival within nodule environments

  • Improved nutrient exchange across the symbiosome membrane

  • Enhanced resistance to stress conditions during the symbiotic relationship

Environmental Stress Adaptation:
Engineering R. loti strains with modified uppP1 regulation could improve symbiotic performance under challenging environmental conditions such as:

  • Drought stress (enhancing water-limited survival)

  • Soil acidity (improving tolerance to low pH)

  • Temperature extremes (maintaining envelope integrity)

These applications represent promising directions for leveraging fundamental understanding of uppP1 function to develop improved biofertilizers and reduce dependency on chemical nitrogen fertilizers in agricultural systems.

What are the key remaining knowledge gaps in our understanding of Rhizobium loti uppP1?

Despite significant advances, several important knowledge gaps remain in our understanding of Rhizobium loti uppP1:

Structural-Functional Relationships:
While the general function of uppP1 is established, the precise structural basis for its catalytic mechanism remains incompletely characterized. Critical questions include how substrate specificity is determined and how the protein's membrane topology influences its activity in different cellular contexts during symbiosis.

Regulatory Networks:
The regulatory mechanisms controlling uppP1 expression during the transition from free-living to symbiotic states remain poorly understood. Identification of transcription factors, small RNAs, and post-translational modifications that modulate uppP1 activity would provide valuable insights into symbiotic adaptation.

Integration with Symbiotic Signaling:
How uppP1 activity is coordinated with other symbiosis-specific processes, including Nod factor production, exopolysaccharide synthesis, and type III secretion systems, requires further investigation. The potential cross-talk between these pathways represents an important area for future research.

Evolution and Diversification: While evidence suggests uppP1 has undergone adaptive evolution in symbiotic bacteria, the specific selective pressures driving this evolution and the functional consequences of lineage-specific adaptations remain to be fully characterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.