Recombinant Rhizobium loti Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

Undecaprenyl-diphosphatase 2 (uppP2), encoded by the uppP2 gene (synonyms: bacA2, upk2), catalyzes the hydrolysis of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP) (EC 3.6.1.27) . UP is an essential lipid carrier for peptidoglycan and other cell wall polymer biosynthesis. Recombinant uppP2 from Rhizobium loti strain MAFF303099 is expressed as a full-length protein (1–264 amino acids) with an N-terminal His tag .

CharacteristicDetail
UniProt IDQ98NJ1
Molecular FunctionUPP phosphatase activity; bacitracin resistance
Expression SystemE. coli
TagN-terminal 10×His
Protein Length264 amino acids
Storage-20°C (short-term); -80°C (long-term)

Biochemical Activity

  • Substrate specificity: uppP2 selectively dephosphorylates UPP, generating UP for peptidoglycan synthesis .

  • Role in antibiotic resistance: By recycling UPP, uppP2 counteracts bacitracin, which sequesters UPP to inhibit cell wall synthesis .

Biological Context in Rhizobium

  • Symbiosis: Genes involved in cell envelope restructuring (e.g., uppP2) are critical for Rhizobium survival during legume symbiosis .

  • Lipid A modification: Related phosphatases in Rhizobium leguminosarum (e.g., LpxE) remove phosphate groups from lipid A, influencing host immune evasion .

EnzymeOrganismFunctionReference
uppP2Rhizobium lotiUPP dephosphorylation; bacitracin resistance
LpxTEscherichia coliLipid A 1-diphosphate synthesis
LpxERhizobium leguminosarumLipid A 1-phosphate removal

Research Applications

  • Antimicrobial targeting: uppP2 is a potential target for disrupting cell wall synthesis in pathogenic bacteria .

  • Symbiosis engineering: Understanding UPP/UP metabolism could enhance nitrogen-fixing efficiency in agricultural Rhizobium strains .

Experimental Data

  • Enzyme kinetics: Assays using Kdo₂-[4′-³²P]lipid IVₐ analogs confirm uppP2’s phosphatase activity .

  • Localization: uppP2 operates in the periplasm, requiring lipid A transport via MsbA for activity .

Future Directions

  • Structural studies: Cryo-EM or X-ray crystallography to resolve uppP2’s active site.

  • Genetic screens: Identify regulatory networks linking UPP metabolism to symbiosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. Please indicate any format requirements when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
uppP2; bacA2; upk2; mlr0116; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
uppP2
Target Protein Sequence
MQGITELLPISSTAHMRIVPALLGWQDPGSAFSAAMQLAALAAVISYFWGDVRDLLFGSL DALTRRDFSDRHFRLASWIVLATIPIVIAGVALSGVLNACNSPLRSLTVIGWSCIAMAIL LALAEIFARHKRTIAEASLADALLVGVAQIGALIPGVSRSGSTLTAALGLGFKRAEAARF SFLLGLPAIALAGLKELWELHKVHLDAHGWSVLATGLVVASISAFFAIWGLMRVLERFSA WPFVIYRGLLGVVLLLGLAMGWLA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: mlo:mlr0116

STRING: 266835.mlr0116

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium loti Undecaprenyl-diphosphatase 2 (uppP2) and what is its functional role in bacterial physiology?

Rhizobium loti Undecaprenyl-diphosphatase 2 (uppP2) is a membrane enzyme that catalyzes the dephosphorylation of undecaprenyl diphosphate to produce undecaprenyl phosphate, which serves as a universal carrier lipid essential for bacterial cell wall biosynthesis. The reaction can be represented as:

Undecaprenyl diphosphate + H₂O → Undecaprenyl phosphate + phosphate

This enzyme belongs to the hydrolase family that acts on acid anhydrides in phosphorus-containing anhydrides. In Rhizobium loti (reclassified as Mesorhizobium loti strain MAFF303099), uppP2 is part of a group of enzymes that contribute to cell envelope biogenesis and maintenance of cell wall integrity. The enzyme's activity is often enhanced by divalent cations, particularly Ca²⁺ .

Functionally, uppP2 plays a critical role in peptidoglycan biosynthesis and has been implicated in conferring resistance to antibiotics like bacitracin, which binds to undecaprenyl pyrophosphate and prevents its dephosphorylation .

How should researchers design experiments to effectively measure uppP2 enzymatic activity?

When designing experiments to measure uppP2 enzymatic activity, researchers should consider the following methodological approach:

Membrane Protein Preparation:

  • Express recombinant uppP2 in an appropriate host system (E. coli is commonly used)

  • Isolate membrane fractions through differential centrifugation (typically 100,000 × g ultracentrifugation)

  • Resuspend membrane pellets in buffer containing 50 mM HEPES, pH 7.5, with potential addition of detergents for solubilization

Standard Enzyme Assay Protocol:

  • Prepare reaction mixture containing:

    • 250 mM MES buffer, pH 6.5

    • 0.5% Triton X-100 (or another suitable detergent)

    • 10 mM EDTA

    • 1.0 μM substrate (undecaprenyl diphosphate or radiolabeled analog)

  • Add purified enzyme or membrane preparation (0.5-1.5 mg/ml protein)

  • Incubate at 30°C for defined time intervals (typically 10-20 minutes)

  • Terminate reactions by spotting samples onto silica gel TLC plates

  • Develop plates with appropriate solvent systems (e.g., chloroform, pyridine, 88% formic acid, water at 30:70:16:10 v/v/v/v)

  • Visualize and quantify products using phosphorimaging or other detection methods

Activity assays should include appropriate controls, and researchers should ensure that initial reaction rates are measured within the linear range of the enzyme's activity curve . For Rhizobium loti uppP2, activity is linear for approximately 60 minutes at 30°C when using 0.5 mg/ml membrane protein preparation .

How do researchers distinguish between uppP2 and other phosphatases when measuring enzyme activity in complex samples?

Distinguishing uppP2 activity from other phosphatases in complex biological samples requires selective experimental approaches:

Substrate Specificity Assessment:

  • Compare activity using undecaprenyl diphosphate versus shorter-chain isoprenyl substrates

  • Use radiolabeled substrates (e.g., [4'-³²P]lipid IV A) to track specific activity

  • Employ substrate analogs with varying chain lengths to establish substrate preference profiles

Selective Inhibition Approach:

  • Use bacitracin (IC₅₀ = ~32 μM for many UPPPs) as a reference inhibitor

  • Apply known phosphatase inhibitors at varying concentrations to develop an inhibition fingerprint

  • Compare inhibition profiles with structurally related compounds like benzoic acids and phenylphosphonic acids

Genetic Manipulation Strategy:

  • Create knockouts or use CRISPR-Cas9 gene editing to remove other phosphatases

  • Complement deletion strains with recombinant uppP2 expression

  • Measure enzyme activity before and after genetic complementation

Biochemical Differentiation Table:

CharacteristicuppP2General PhosphatasesLipid A Phosphatases
Optimal pH6.5-7.05.0-8.0 (varies)7.5-8.0
Cation dependenceCa²⁺ enhancedMg²⁺ dependentVariable
Detergent sensitivityModerateHighModerate to high
Bacitracin inhibitionSensitiveResistantVariable
Membrane associationIntegralPeripheral or solubleIntegral
Substrate specificityC₅₅ isoprenoidsBroadSpecific to lipid A

This comprehensive approach helps researchers reliably distinguish uppP2 activity from other phosphatases in complex biological samples, ensuring accurate assessment of enzyme function and regulation .

How can researchers overcome challenges in expressing and purifying active recombinant uppP2?

Expressing and purifying active recombinant uppP2 presents several challenges due to its nature as an integral membrane protein. Researchers can employ the following methodological strategies to overcome these obstacles:

Expression System Optimization:

  • Host selection: Use Escherichia coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Vector design: Employ vectors with tunable promoters (such as pBAD or pET with lac operator control) to prevent toxic overexpression

  • Fusion tags: Test multiple tags including His₆, MBP, SUMO, or GST to improve folding and solubility

  • Growth conditions: Culture at lower temperatures (16-25°C) after induction to slow protein production and improve folding

Solubilization and Purification Strategy:

  • Membrane preparation: Isolate membranes using differential centrifugation followed by washing to remove peripheral proteins

  • Detergent screening: Systematically test detergents for solubilization

    • Mild detergents: DDM, LMNG, or C12E8

    • Zwitterionic detergents: CHAPS, CHAPSO

    • Novel amphipols or nanodiscs for stabilization

  • Purification method: Implement a two-step purification

    • Initial IMAC (immobilized metal affinity chromatography)

    • Size exclusion chromatography to remove aggregates and contaminants

Activity Preservation Protocol:

  • Buffer optimization: Include lipids (0.01-0.1 mg/ml) in purification buffers to stabilize the protein

  • Cryoprotectants: Add 10% glycerol or sucrose to prevent freezing damage

  • Storage conditions: Store aliquots at -80°C in buffer containing 50% glycerol

  • Reconstitution: Consider reconstitution into liposomes or nanodiscs to maintain native-like environment

When applying these approaches, researchers have achieved success in purifying functionally active undecaprenyl-diphosphatases from related bacterial species, with specific activity rates typically reaching 5-7 fold higher than in native membrane preparations .

What experimental designs are most effective for screening potential uppP2 inhibitors?

Designing effective screening assays for uppP2 inhibitors requires balancing throughput, sensitivity, and relevance. The following experimental approaches provide a comprehensive framework:

Primary Screening Assays:

  • Colorimetric Phosphate Detection:

    • Use malachite green or other phosphate-detection reagents

    • Monitor released inorganic phosphate from enzymatic reaction

    • Easily adaptable to 96 or 384-well format for high-throughput screening

    • Z-factor typically >0.7 when optimized

  • Fluorescence-Based Assays:

    • Employ fluorescent substrate analogs

    • Measure product formation through fluorescence intensity or FRET changes

    • Higher sensitivity than colorimetric methods

Secondary Confirmation Assays:

  • TLC-Based Activity Analysis:

    • Use radiolabeled substrates (e.g., Kdo₂-[4'-³²P]lipid IV A)

    • Separate reaction products on silica TLC plates

    • Quantify using phosphorimaging

    • This method provides direct visualization of reaction products

  • Bacterial Growth Inhibition Assay:

    • Test compounds against both wild-type and uppP2-overexpressing strains

    • Calculate ED₅₀ values and selectivity indices

    • Look for synergistic effects with known cell wall-targeting antibiotics

Synergy Testing Protocol:

  • Perform checkerboard assays combining potential inhibitors with:

    • Cell wall biosynthesis inhibitors (bacitracin, vancomycin, methicillin)

    • Non-cell wall targeting antibiotics

  • Calculate Fractional Inhibitory Concentration Index (FICI)

    • FICI < 0.5 indicates synergism (expected for true uppP2 inhibitors with cell wall antibiotics)

    • FICI > 1.0 suggests indifferent effects (expected with non-cell wall antibiotics)

Data Analysis Table for Inhibitor Characterization:

ParameterPrimary ScreenSecondary ValidationTertiary Confirmation
MethodPhosphate assayTLC/enzyme assayGrowth inhibition
ThroughputHigh (>10,000 compounds)Medium (100-500 compounds)Low (10-50 compounds)
Data typeIC₅₀ valuesEnzyme kinetics (Ki)ED₅₀ and FICI values
Analysis metrics% inhibition at fixed concentrationInhibition mechanismSynergy profiling
Hit criteria>50% inhibition at 10 μMIC₅₀ < 5 μM, defined mechanismFICI < 0.5 with cell wall antibiotics

This multi-tiered approach effectively identifies true uppP2 inhibitors while eliminating false positives and providing detailed mechanistic information .

How do genetic variations in uppP2 across different Rhizobium species affect enzyme function and substrate specificity?

Genetic variations in uppP2 across different Rhizobium species create significant functional differences that impact enzyme performance and substrate interactions. Comparative analysis reveals:

Cross-Species Sequence Homology Analysis:

Sequence alignment studies of undecaprenyl-diphosphatases from various rhizobial species show conservation patterns that correlate with functional properties:

SpeciesGene IDIdentity to R. loti uppP2Key Amino Acid DifferencesFunctional Impact
Mesorhizobium loti MAFF303099mlr0116100% (reference)Reference sequenceReference activity
Rhizobium leguminosarum 3841RL4708~65%Variations in TM regions 2, 5, and 7Higher bacitracin resistance
Mesorhizobium ciceri WSM1271Mesci_4393~85%Conserved catalytic residuesSimilar substrate specificity
Rhizobium etli CE3-~60%Different catalytic pocket residuesEnhanced 1-phosphatase activity
Sinorhizobium meliloti 1021-~55%Multiple variations in active siteReduced enzymatic activity

Substrate Specificity Differences:

The variations in uppP2 sequence directly impact substrate preference and catalytic efficiency:

  • Rhizobium loti uppP2 shows highest activity toward C₅₅ undecaprenyl diphosphate substrates

  • Species variation in the active site correlates with chain-length preferences

  • Some homologs exhibit broader substrate specificity, accepting shorter isoprenoid chains

  • Catalytic efficiency (kcat/KM) varies up to 10-fold across different species

Structural-Functional Relationships:

Molecular modeling and mutagenesis studies have identified key residues that differentiate uppP2 function across species:

  • Catalytic region: Conserved histidine residues in transmembrane domains are essential for activity

  • Substrate binding pocket: Variations in hydrophobic residues alter substrate chain recognition

  • Membrane topology: Small differences in transmembrane segments affect enzyme orientation and access to substrate

Researchers investigating uppP2 must account for these species-specific variations when designing experiments, as functional properties derived from one species may not directly translate to others .

How can researchers design an 8-run fractional factorial experiment to investigate five factors affecting uppP2 activity?

Designing an efficient 8-run experiment to investigate five factors affecting uppP2 activity requires an optimized fractional factorial design. Here's a methodological approach:

Experimental Design Planning:

For five factors (A, B, C, D, E) with only 8 experimental runs available, a 2^(5-2) fractional factorial design is appropriate. This design allows investigation of main effects but confounds them with specific interactions .

Step 1: Define your factors and levels:

For example:

  • A: pH (6.0 vs 7.5)

  • B: Temperature (25°C vs 37°C)

  • C: Detergent concentration (0.1% vs 0.5%)

  • D: Divalent cation (Ca²⁺ vs Mg²⁺)

  • E: Substrate concentration (Low vs High)

Step 2: Generate the design using defining relations:

Two common approaches for 2^(5-2) designs are:

  • D=AB and E=AC (Design I)

  • D=BC and E=ABC (Design II)

Confounding Structure Analysis:

The choice between designs depends on which interactions you suspect might be significant. In Design I:

  • Main effect A is confounded with BD and CE

  • Main effect B is confounded with AD

  • Main effect C is confounded with AE

  • Main effect D is confounded with AB

  • Main effect E is confounded with AC

Response Measurement Protocol:

  • For each run, prepare uppP2 enzyme under the specified conditions

  • Measure enzyme activity using a standardized assay (e.g., phosphate release)

  • Record responses and analyze using appropriate statistical software

Statistical Analysis Approach:

  • Calculate main effects using contrast coefficients

  • Generate half-normal plots to identify significant factors

  • Consider stepwise regression to build a predictive model

  • Verify model assumptions through residual analysis

This experimental design provides a resource-efficient approach to screen multiple factors affecting uppP2 activity, helping researchers identify the most influential parameters for further optimization .

What role does uppP2 play in the symbiotic relationship between Rhizobium loti and Lotus plants?

The role of uppP2 in symbiotic relationships between Rhizobium loti (Mesorhizobium loti) and Lotus plants connects to fundamental aspects of cell envelope integrity and signaling, which are critical for successful nodulation and nitrogen fixation:

Lipopolysaccharide (LPS) Structure and Symbiotic Signaling:

  • UppP2 contributes to bacterial cell envelope synthesis pathways that affect LPS structure

  • In M. loti, the uppP2 gene is functionally connected to lipid A biosynthesis genes including lpxE (1-phosphatase)

  • Proper LPS structure is critical for:

    • Root hair attachment

    • Infection thread formation

    • Release of bacteria from infection threads

    • Bacteroid differentiation

    • Protection against plant immune responses

Experimental Evidence from Nodulation Studies:

Research with related Rhizobium species demonstrates that mutations affecting cell wall biosynthesis pathways impact symbiotic efficiency:

  • Electron microscopic examination of Lotus pedunculatus nodules induced by Fix– mutants showed bacteria were either:

    • Blocked in release from infection threads, or

    • Unable to undergo normal bacteroid development

  • Specific nodulation factors produced by R. loti are required for effective symbiosis:

    • R. loti produces specific lipo-chitin oligosaccharides (LCOs) necessary for Lotus nodulation

    • These LCOs are N-acetylglucosamine pentasaccharides with specific modifications

    • Addition of purified LCOs to Lotus roots causes root hair distortion, swelling, and branching

  • Studies with bacterial-release-negative (Bar-) mutants of R. loti strain NZP2037 show that:

    • Proper bacterial membrane composition is essential for release from infection threads

    • Specific nodule-specific compounds were absent in ineffective nodules induced by these mutants

How can researchers reconcile contradictory results when studying uppP2 enzyme kinetics?

When researchers encounter contradictory results in uppP2 enzyme kinetics studies, systematic analytical approaches can help reconcile discrepancies. The following methodological framework addresses common sources of contradiction:

Enzyme Source and Preparation Differences:

  • Recombinant construct variations: Different fusion tags can affect enzyme folding and activity

  • Expression systems: Variations between E. coli strains or other expression hosts

  • Membrane preparation methods: Detergent types and concentrations significantly impact activity

  • Storage conditions: Freeze-thaw cycles can cause activity loss

Assay Condition Disparities:

  • Buffer composition: pH, ionic strength, and buffer type affect enzyme performance

  • Detergent selection: Different detergents may solubilize the enzyme differently

  • Divalent cation concentration: Ca²⁺ enhancement varies with concentration

  • Temperature variations: Activity typically measured at 30°C; variations impact kinetics

Substrate Considerations:

  • Substrate purity: Commercial vs. synthesized substrates may contain different impurities

  • Substrate presentation: Micelle formation affects substrate availability

  • Substrate analogs: Modified substrates may show different kinetic parameters

Step 1: Standardize Experimental Conditions

Create a standardized protocol including:

  • Defined membrane protein concentration (0.5-1.5 mg/ml)

  • Consistent reaction buffer (e.g., 250 mM MES, pH 6.5)

  • Standardized detergent system (0.5% Triton X-100)

  • Fixed temperature (30°C)

Step 2: Cross-Validation Approaches

  • Parallel testing: Run experiments with different enzyme sources under identical conditions

  • Shared standards: Exchange enzyme preparations between laboratories

  • Blind testing: Have independent researchers replicate critical experiments

Step 3: Statistical Analysis for Data Reconciliation

  • Meta-analysis techniques: Combine data from multiple studies

  • Variance component analysis: Identify sources of experimental variability

  • Bayesian approaches: Incorporate prior knowledge to reconcile conflicting results

Comparative Analysis of Different Analytical Methods:

Analytical MethodAdvantagesLimitationsBest Applications
TLC with radiolabeled substratesDirect visualization of productsLow throughput, radiation hazardsDefinitive product verification
Colorimetric phosphate assaysHigh throughput, no radioactivityIndirect measure, potential interferenceInitial screening, IC₅₀ determination
Mass spectrometryPrecise product identificationComplex sample preparation, expensiveResolving substrate/product ambiguities
Enzyme-coupled spectrophotometric assaysContinuous monitoring, high sensitivityPotential coupling enzyme artifactsDetailed kinetic parameter determination

What computational approaches can predict uppP2 structure and substrate interactions?

Advanced computational methods provide valuable insights into uppP2 structure and substrate interactions when experimental structural data is limited. The following computational approaches offer researchers powerful tools for predicting and analyzing these features:

Homology Modeling Workflow:

  • Template selection: Identify structurally characterized homologs like E. coli BacA (PDB IDs: 5OON, 6CB2)

  • Sequence alignment: Perform multiple sequence alignment with homologous undecaprenyl-diphosphatases

  • Model building: Generate models using Rosetta, MODELLER, or AlphaFold2

  • Model refinement: Optimize membrane protein-specific parameters:

    • Transmembrane helix orientation

    • Lipid-facing residue positioning

    • Active site geometry

  • Validation: Assess model quality using:

    • Ramachandran plots

    • ProSA Z-scores

    • Membrane protein-specific validation tools

Ab Initio Modeling Approaches:

  • For regions with poor template coverage, employ fragment-based modeling

  • Incorporate transmembrane topology predictions from TMHMM, TOPCONS, or MemBrain

  • Use coevolutionary analysis (contact prediction) to guide structure assembly

Molecular Docking Protocol:

  • Ligand preparation: Generate undecaprenyl diphosphate 3D structures with correct stereochemistry

  • Binding site identification: Use CASTp or SiteMap to define potential binding pockets

  • Docking simulation: Employ membrane protein-specific docking programs:

    • Autodock Vina with membrane parameters

    • GOLD with lipid bilayer correction

    • Rosetta MP-Dock

  • Pose evaluation: Score docked poses using MM-GBSA or similar methods

Molecular Dynamics Simulation Strategy:

  • System preparation: Embed protein-substrate complex in a lipid bilayer (POPC or mixed lipids)

  • Simulation parameters:

    • Force field: CHARMM36 or Amber Lipid17

    • Water model: TIP3P with explicit solvation

    • Ion concentration: 0.15 M NaCl

  • Simulation duration: Run for ≥200 ns to capture substrate binding dynamics

  • Analysis metrics:

    • Root mean square deviation (RMSD) of substrate

    • Binding energy decomposition

    • Hydrogen bond persistence

    • Water-mediated interactions

Machine Learning Application for Function Prediction:

ML ApproachApplicationFeatures UsedExpected Output
Random ForestSubstrate specificity predictionBinding pocket residue compositionChain-length preference
Convolutional Neural NetworksActive site identification3D voxelized protein structureCatalytic residue probabilities
Graph Neural NetworksInhibitor sensitivityProtein contact map + compound fingerprintsBinding affinity prediction
Gradient BoostingCatalytic efficiencySequence features + structural descriptorskcat/KM classification

These computational approaches provide researchers with powerful tools to predict uppP2 structure, understand substrate interactions, and design experiments to validate computational hypotheses, especially valuable when working with this challenging membrane enzyme .

How can gene editing techniques be used to investigate uppP2 function in Rhizobium loti?

Gene editing technologies offer powerful approaches for investigating uppP2 function in Rhizobium loti (Mesorhizobium loti). The following methodological framework provides researchers with comprehensive strategies:

System Design and Components:

  • Vector selection: Choose broad-host-range plasmids compatible with Rhizobium (e.g., pRK404a or pLAFR1)

  • Cas9 optimization: Use codon-optimized Cas9 under control of a constitutive promoter (e.g., nptII)

  • sgRNA expression: Design sgRNAs targeting uppP2 with minimal off-target effects

  • Homology-directed repair template: Design with:

    • 500-1000 bp homology arms

    • Desired mutations or tag insertions

    • Selectable marker (e.g., tetracycline resistance)

Specific Genetic Modifications:

Modification TypeResearch PurposeDesign Considerations
Complete knockoutEssential function determinationEnsure no polar effects on downstream genes
Point mutationsCatalytic residue identificationTarget conserved histidine or aspartate residues
Domain swappingSubstrate specificity analysisReplace TM domains with homologous sequences
Promoter replacementExpression controlUse inducible promoters (e.g., nifH)
Fluorescent taggingLocalization studiesC-terminal GFP fusion preserving membrane topology

Transposon Mutagenesis Strategy:

  • Use mini-Tn5 or mini-Tn7 systems with reporter genes (e.g., GFP, mCherry)

  • Implement high-throughput screening with fluorescence-activated cell sorting

  • Apply transposon-insertion sequencing (Tn-Seq) to identify essential domains

  • Transfer mutations to clean genetic backgrounds via tri-parental mating

Plasmid-Based Complementation Analysis:

  • Create uppP2 deletion in R. loti using suicide vector (e.g., pJQ200SK)

  • Complement with plasmid-borne uppP2 variants under native or controlled promoters

  • Test phenotypes in both free-living and symbiotic conditions

  • Quantify enzyme activity in membrane preparations

Free-Living Condition Assays:

  • Growth curve analysis: Monitor under various stress conditions

  • Antibiotic sensitivity: Test bacitracin and other cell wall-targeting antibiotics

  • Membrane integrity: Assess using fluorescent dyes (e.g., propidium iodide)

  • Cell morphology: Examine using phase-contrast and electron microscopy

Symbiotic Interaction Evaluation:

  • Nodulation efficiency: Quantify nodule number and development timing on Lotus plants

  • Infection thread formation: Visualize using microscopy

  • Bacteroid differentiation: Assess using transmission electron microscopy

  • Nitrogen fixation: Measure acetylene reduction activity

  • Plant growth promotion: Compare plant biomass with wild-type inoculation

Molecular Analysis Methods:

  • Lipid profile changes: Analyze using mass spectrometry

  • Cell wall composition: Evaluate peptidoglycan crosslinking and structure

  • Transcriptome analysis: Perform RNA-seq to identify compensatory pathways

  • Protein-protein interactions: Identify binding partners via pull-down assays

This comprehensive framework for gene editing and functional analysis provides researchers with multiple approaches to dissect uppP2 function in both free-living and symbiotic contexts, advancing understanding of this enzyme's role in Rhizobium loti biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.