Recombinant Rhizobium loti UPF0187 protein mll4386 (mll4386) is a protein derived from the bacterium Rhizobium loti . Rhizobium loti is a Gram-negative bacterium known for its symbiotic relationship with leguminous plants, where it fixes atmospheric nitrogen in root nodules, benefiting the plant . The protein is also referred to as UPF0187 protein mll4386, with mll4386 being the ordered locus name or gene name .
The protein consists of 309 amino acids. The complete amino acid sequence is as follows :
MPVRERPSMIVRPRPNFLQLFFIMRGSVVPRILPQIFGFAVYSAVILALARWFELDLGVF
NITPFGLVGVTLSIYLSFRNNAAYDRWWEARKLWGTLVFEIRNLARATTSLIPDPAEQRA
LLMEALAFCHFLRGQLRKTDSIKDARAFIDAQAETVAGFANPADEMVRRMGRRANAQRRA
GDVDPIGFRILDERLASITAIQAGCERIAGTPLPFAYTLLVHRTAYIVCLLLPIGLISTT
GWATPLFTALIAYTFFGLDALSEELEDPFGTEANDLALDGLCRVCEISVFEALGEAPPKM
LPAEKFYFS
Recombinant Rhizobium loti UPF0187 protein mll4386 (mll4386) is produced using an in vitro E. coli expression system . It is expressed as a full-length protein (1-309 amino acids) with an N-terminal 10xHis tag to facilitate purification . The protein is typically purified using affinity chromatography, taking advantage of the His tag's affinity for nickel or other metal ions .
The protein is annotated as a UPF0187 protein, which stands for "Unknown Protein Function 0187" . Proteins in the UPF0187 family are found in various bacterial species, but their precise functions are not well-characterized . Rhizobium loti establishes a symbiotic relationship with leguminous plants, forming root nodules where nitrogen fixation occurs . Understanding the roles of proteins like mll4386 may provide insights into the molecular mechanisms underlying this symbiosis . Some rhizobia utilize pathogenic-like effectors to promote leguminous nodulation signaling .
Rhizobium loti plays a crucial role in symbiotic nitrogen fixation, converting atmospheric nitrogen into ammonia that the plant can use . The apn1 mutant (aspartic peptidase nodule-induced 1) impairs symbiotic nitrogen fixation . The nodule-specific aspartic peptidase, APN1, suppresses negative effects of the rhizobial autotransporter to maintain effective symbiotic nitrogen fixation .
KEGG: mlo:mll4386
STRING: 266835.mll4386
Rhizobium loti UPF0187 protein mll4386 is a 309-amino acid transmembrane protein encoded by the mll4386 gene in Rhizobium loti (strain MAFF303099), also known as Mesorhizobium loti. The protein belongs to the UPF0187 family of uncharacterized proteins, which typically indicates proteins with conserved sequences but unknown functions. The protein has a UniProt identifier of Q98E66 and appears to be involved in membrane-associated processes based on its hydrophobic regions and predicted transmembrane domains .
Based on the amino acid sequence analysis, mll4386 displays several key structural features typical of membrane proteins. The protein contains multiple hydrophobic regions that likely span the cell membrane, with alternating hydrophilic segments that may project into cytoplasmic or periplasmic spaces. The presence of charged amino acids (such as arginine and lysine) in specific segments suggests potential interaction sites with other proteins or nucleic acids. The characteristic transmembrane helices indicate that mll4386 likely functions within the bacterial membrane system, potentially involved in transport or signaling processes related to Rhizobium-legume symbiosis .
The recombinant mll4386 protein is optimally expressed in E. coli expression systems with an N-terminal His-tag (either 6x or 10x depending on the commercial product). For maximum expression efficiency, researchers should consider the following parameters:
Expression System: E. coli BL21(DE3) or similar strains
Vector: pET series vectors with T7 promoter
Induction: 0.5-1.0 mM IPTG when culture reaches OD600 = 0.6-0.8
Temperature: Reduce to 16-18°C post-induction for membrane proteins
Duration: Extended expression (16-20 hours) at lower temperatures
This approach minimizes inclusion body formation while maximizing functional protein yield, as evidenced by the commercial production processes developed for this transmembrane protein .
Effective purification and storage of recombinant mll4386 requires specific conditions to maintain protein stability and functionality:
These guidelines ensure maximum protein stability and activity for experimental applications while minimizing degradation during storage periods .
Validating recombinant mll4386 requires a multi-faceted approach to confirm both identity and quality:
SDS-PAGE Analysis: Commercial preparations typically show >90% purity by SDS-PAGE, with the protein migrating at approximately 34-36 kDa (including His-tag) .
Western Blot: Anti-His antibody detection confirms the presence of the tagged protein.
Mass Spectrometry: Peptide mass fingerprinting provides definitive sequence verification.
Circular Dichroism (CD): Evaluates secondary structure content, particularly important for transmembrane proteins.
Dynamic Light Scattering: Assesses protein homogeneity and aggregation state.
Researchers should implement at least three of these validation methods to ensure experimental reproducibility when working with this relatively uncharacterized protein .
The mll4386 protein offers several experimental approaches for investigating Rhizobium-legume symbiotic relationships:
Protein Localization Studies: Using fluorescently tagged mll4386 to determine its spatial distribution during nodule formation and nitrogen fixation processes.
Protein-Protein Interaction Assays: Employing pull-down assays with recombinant mll4386 to identify binding partners within both bacterial and plant systems.
Comparative Expression Analysis: Quantifying mll4386 expression levels across different stages of symbiotic association can reveal its temporal importance.
Functional Complementation: Testing whether mll4386 can restore symbiotic capabilities in mutant strains lacking specific membrane functions.
These approaches can be integrated with established experimental evolution techniques similar to those used in other Rhizobium-legume studies, where bacteria are passaged through multiple plant infection cycles to identify adaptations enhancing symbiotic benefits .
Given the uncharacterized nature of the UPF0187 protein family, determining the function of mll4386 requires multiple complementary approaches:
Gene Knockout Studies: Creating mll4386 deletion mutants in Rhizobium loti to observe phenotypic changes in growth, survival, and symbiotic capacity.
Conditional Expression Systems: Developing inducible promoter constructs to modulate mll4386 expression levels and observe dosage effects.
Site-Directed Mutagenesis: Systematically altering conserved amino acid residues to identify functionally critical domains.
Heterologous Expression: Expressing mll4386 in non-nodulating bacteria to test whether it confers novel capabilities related to plant interaction.
Transcriptomic Analysis: Comparing gene expression profiles between wild-type and mll4386 mutant strains to identify affected pathways.
These methodologies, particularly when applied in the context of symbiotic associations with Lotus species as described in related literature, can provide significant insights into protein function .
The chromosomal transfer of symbiotic genes between Rhizobium strains represents a significant mechanism for evolution of symbiotic capabilities. When investigating mll4386's potential role in this process:
Genomic Context Analysis: Examine the chromosomal location of mll4386 relative to known symbiotic islands or regions subject to horizontal gene transfer.
Comparative Genomics: Analyze the presence and sequence conservation of mll4386 across diverse Rhizobium isolates with different symbiotic capabilities.
DNA Binding Assays: Test whether mll4386 possesses DNA binding capacity that might facilitate genetic exchange.
Co-evolution Studies: Investigate whether mll4386 shows evidence of co-evolution with known symbiotic genes.
Previous research has demonstrated that chromosomal symbiotic regions (at least 105 kb) can transfer between Rhizobium strains in environmental settings, leading to the emergence of new nodulating strains with diverse genetic backgrounds. Understanding whether mll4386 participates in or is affected by such transfer events could provide valuable insights into rhizobial evolution .
Analysis of the mll4386 sequence reveals several structural features that provide clues to its potential functions:
Transmembrane Domains: The protein contains multiple hydrophobic regions consistent with transmembrane helices, suggesting a role in membrane organization, transport, or signaling.
Conserved Motifs: Several sequence motifs are shared with other UPF0187 family members, including:
An N-terminal MPVRER motif potentially involved in protein localization
A central LIPDPAEQRA sequence that may participate in protein-protein interactions
C-terminal DLALD and VFEAL motifs often associated with enzymatic activity
Charged Residue Distribution: The distribution of positively charged residues suggests potential interaction with negatively charged phospholipid headgroups or nucleic acids.
These structural elements, combined with its conservation across rhizobial species, indicate mll4386 likely plays a fundamental role in bacterial membrane function potentially related to symbiotic processes .
The UPF0187 protein family represents a group of uncharacterized bacterial proteins with conserved sequence features. When comparing mll4386 to other family members:
This comparative analysis highlights that while core structural features are conserved, suggesting a fundamental cellular function, variations in transmembrane topology may reflect adaptations to specific bacterial lifestyles, particularly in symbiotic species .
Researchers face several significant challenges when investigating mll4386:
Protein Solubility: As a transmembrane protein, mll4386 presents inherent solubility challenges during purification and functional studies, requiring specialized detergent-based methodologies.
Functional Redundancy: Potential redundancy with other membrane proteins may mask phenotypic effects in single-gene knockout studies.
Limited Homology: The uncharacterized nature of the UPF0187 family means few characterized homologs exist to guide functional hypotheses.
Technical Limitations: Studying membrane protein dynamics in the context of plant-microbe interactions presents technical challenges for in vivo imaging and functional assays.
Environmental Variability: Symbiotic processes are highly dependent on environmental conditions, requiring carefully controlled experimental conditions to generate reproducible results.
Addressing these challenges requires multidisciplinary approaches combining structural biology, genetics, and plant-microbe interaction studies .
The study of mll4386 could significantly enhance experimental evolution research in Rhizobium-legume symbiosis:
Molecular Marker: Changes in mll4386 sequence or expression could serve as molecular markers for tracking evolutionary adaptations during passage experiments.
Functional Target: As a membrane protein, mll4386 might be directly involved in host-microbe recognition or nutrient exchange processes that undergo selection during host adaptation.
Experimental Design: Including mll4386 analysis in experimental evolution studies could involve:
Tracking sequence changes during multiple plant passages
Monitoring expression changes in adapted strains
Testing for correlation between mll4386 variants and symbiotic performance metrics
Recent research has demonstrated that rhizobia can evolve enhanced symbiotic benefits through experimental evolution involving repeated cycles of plant infection. Such approaches could be applied to specifically investigate the role of mll4386 in adapting to novel legume hosts .
Advancing knowledge about mll4386 requires integration of multiple research disciplines:
Structural Biology: Cryo-electron microscopy and X-ray crystallography to determine the three-dimensional structure.
Systems Biology: Network analysis to position mll4386 within broader cellular pathways.
Synthetic Biology: Engineering mll4386 variants with altered properties to test structure-function hypotheses.
Plant-Microbe Ecology: Field studies examining the correlation between mll4386 variants and symbiotic effectiveness in diverse environments.
Comparative Genomics: Analyzing mll4386 conservation across soil bacteria with varying plant association capabilities.
Such interdisciplinary approaches could reveal not only the specific function of mll4386 but also its broader significance in the evolution of plant-microbe symbioses and potential applications in agricultural microbiology .