Recombinant Rhizobium loti UPF0283 membrane protein mlr0776 (mlr0776)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mlr0776; UPF0283 membrane protein mlr0776
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
mlr0776
Target Protein Sequence
MTAPRKPAAFRIEPEAAPTQETPKARQAELSRKPRGLKTDVALVIPAEVDVFDEPDIVAA EPPPAAAPRKRSLFGSIFFGAIGVLVSLAVGLWTDQLIRDLFARAEWLGWLAAGMAAIAV LALVVILIREFLAIARLAEVEKLQKRALDAIARDDPKAARSVVDELSAFVAAKPETAAGR RALAELRGEIIDGGNLVRLAEAEILGPLDARAKVMILEAAKRVSLVTAVSPRALVDVAYV VFEAGRLIRRLSELYGGRPGTLGFFRLARSVLAHLAVTGSIAVGDSFVQQIVGHGLAARL SAKLGEGVVNGMMTARIGIAAMETARPLPFSAAKRPGLGDFLSALTSFAAKKDTETTGSG K
Uniprot No.

Target Background

Database Links

KEGG: mlo:mlr0776

STRING: 266835.mlr0776

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium loti UPF0283 membrane protein mlr0776?

Rhizobium loti UPF0283 membrane protein mlr0776 is a 361-amino acid protein integrated into the bacterial membrane with the UniProt ID Q98M18. It belongs to the UPF0283 protein family, whose functions remain largely uncharacterized. Structurally, the protein contains multiple transmembrane domains with characteristic hydrophobic regions suitable for membrane integration. The protein's sequence contains regions suggesting potential alpha-helical structures that likely span the membrane .

The methodological approach to characterizing this protein typically begins with bioinformatic analysis of its sequence using tools such as TMHMM for transmembrane prediction, SignalP for signal peptide identification, and comparative sequence analysis with homologous proteins from related bacterial species. These analyses provide the foundation for designing experimental studies to elucidate function.

How can researchers effectively express and purify recombinant mlr0776?

The expression and purification of recombinant mlr0776 requires a methodical approach optimized for membrane proteins:

  • Expression system selection: E. coli has been successfully used for expression of full-length mlr0776 with N-terminal His-tags . For optimal expression, consider using specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

  • Expression vector design:

    • Incorporate a His-tag (preferably N-terminal as demonstrated) for affinity purification

    • Include appropriate antibiotic resistance markers

    • Select an inducible promoter system (IPTG-inducible or arabinose-inducible)

  • Purification protocol:

    • Cell lysis by sonication or French press in buffer containing mild detergents

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization using detergents (DDM, LDAO, or FC-12)

    • IMAC purification using Ni-NTA resin

    • Size exclusion chromatography for final purification

  • Quality assessment:

    • SDS-PAGE analysis (>90% purity is achievable)

    • Western blotting with anti-His antibodies

    • Mass spectrometry for identity confirmation

What storage conditions are optimal for maintaining mlr0776 stability?

For optimal stability of purified recombinant mlr0776, research indicates the following methodological approach:

  • Short-term storage: Maintain working aliquots at 4°C for up to one week to avoid degradation from repeated freeze-thaw cycles .

  • Long-term storage: Store protein at -20°C/-80°C in smaller aliquots to minimize freeze-thaw damage .

  • Storage buffer composition:

    • Tris/PBS-based buffer with pH 8.0

    • 6% Trehalose as a stabilizing agent

    • Consider adding 5-50% glycerol as cryoprotectant (default recommendation is 50%)

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening

    • Reconstitute lyophilized protein in deionized sterile water

    • Adjust to concentration of 0.1-1.0 mg/mL

How does mlr0776 compare to other membrane proteins in Rhizobium species?

Comparative analysis of mlr0776 with other membrane proteins in Rhizobium species requires a multifaceted approach:

  • Sequence alignment methodology:

    • Multiple sequence alignment using tools like Clustal Omega or MUSCLE

    • Construction of phylogenetic trees to establish evolutionary relationships

    • Domain architecture analysis using InterProScan or SMART

  • Structural comparison:

    • Secondary structure prediction using PSIPRED or JPred

    • Transmembrane topology prediction tools (TMHMM, TOPCONS)

    • Homology modeling when suitable templates are available

  • Functional inference:

    • Gene neighborhood analysis

    • Co-expression pattern examination

    • Analysis of conservation in symbiotic vs. non-symbiotic rhizobia

Research findings suggest that membrane proteins in Rhizobium species may undergo horizontal gene transfer, as demonstrated by the transfer of chromosomal symbiotic genes from inoculant strains to nonsymbiotic rhizobia in the environment . This phenomenon could influence the distribution and diversity of membrane proteins like mlr0776 across different Rhizobium strains.

What reconstitution methods are appropriate for functional studies of mlr0776?

For functional studies of mlr0776, proper reconstitution into lipid environments is crucial:

  • Liposome reconstitution protocol:

    • Prepare lipid mixtures (POPC/POPE/POPG at 7:2:1 ratio)

    • Solubilize lipids in chloroform and create thin films

    • Hydrate with buffer containing purified protein

    • Detergent removal by dialysis or Bio-Beads

    • Verification of proteoliposome formation by dynamic light scattering

  • Planar lipid bilayer formation:

    • Similar protocols to those used for membrane proteins like Channelrhodopsin (ChR1), Bacteriorhodopsin (bR), and SthK channel

    • Incorporation of mlr0776 during bilayer formation or via vesicle fusion

  • Nanodiscs preparation:

    • Assembly with MSP1D1 scaffold protein

    • Detergent removal to drive nanodisc formation

    • Size exclusion purification of protein-containing nanodiscs

These methodologies provide different experimental platforms for studying protein function, with each offering specific advantages depending on the research question being addressed.

How can single-molecule force spectroscopy (SMFS) be applied to study mlr0776 structural dynamics?

SMFS provides valuable insights into membrane protein dynamics through forced unfolding experiments:

  • SMFS experimental design for mlr0776:

    • Reconstitution in lipid bilayers following protocols validated for other membrane proteins

    • AFM cantilever tip approach to apply unfolding force

    • Collection of force-distance curves representing unfolding pathways

    • Analysis of curves using worm-like chain (WLC) model with persistence length of ~0.4 nm

  • Data analysis workflow:

    • Filtering of non-specific binding events

    • Identification of sawtooth patterns characteristic of protein unfolding

    • Clustering of similar unfolding patterns

    • Correlation of peaks with structural elements

  • Structural interpretation:

    • Mapping of force peaks to protein domains

    • Determination of mechanical stability of different regions

    • Identification of potential structural heterogeneity

Research findings indicate that SMFS can reveal:

  • Unfolding pathways from either N- or C-terminus

  • Different unfolding patterns based on attachment point

  • Structural variations that may not be captured by static structural methods

What approaches can identify potential interaction partners of mlr0776 in native membranes?

Identifying mlr0776 interaction partners requires combining multiple methodologies:

  • Proximity-based labeling approaches:

    • BioID fusion construction (mlr0776-BirA*)

    • APEX2 fusion for peroxidase-based labeling

    • In vivo expression and activation of labeling

    • Mass spectrometry identification of labeled proteins

  • Co-immunoprecipitation strategy:

    • Expression of tagged mlr0776 in R. loti

    • Membrane solubilization under mild conditions

    • Affinity purification of protein complexes

    • Mass spectrometry analysis of co-purified proteins

  • Membrane protein complex isolation:

    • Blue native PAGE separation

    • Second dimension SDS-PAGE

    • Protein identification by mass spectrometry

  • Validation methods:

    • FRET analysis with fluorescently tagged candidates

    • Bimolecular fluorescence complementation

    • Co-localization studies by super-resolution microscopy

The unroofing method described for isolating cell membranes with minimal cytoplasmic contamination could be adapted for R. loti to study mlr0776 interactions in its native membrane environment.

How can researchers assess the role of mlr0776 in Rhizobium-legume symbiosis?

Investigating the role of mlr0776 in symbiosis requires a comprehensive experimental framework:

  • Gene deletion/mutation strategy:

    • CRISPR-Cas9 or homologous recombination approaches

    • Construction of deletion mutants

    • Complementation studies with wild-type and mutant variants

    • Phenotypic assessment of symbiotic ability

  • Symbiosis assessment methods:

    • Plant inoculation experiments with wild-type vs. mutant strains

    • Quantification of nodule number, morphology, and leghemoglobin content

    • Nitrogen fixation measurements via acetylene reduction assay

    • Competitive nodulation assays with mixed inoculations

  • Localization during symbiotic stages:

    • Fusion of fluorescent proteins to mlr0776

    • Confocal microscopy tracking during infection and nodule development

    • Immunogold electron microscopy for precise localization

Based on studies with other Rhizobium strains, mlr0776 might be involved in the transfer of symbiotic genes to nonsymbiotic rhizobia, as has been observed with other chromosomally integrated symbiotic DNA regions .

What methods are suitable for determining the membrane topology of mlr0776?

Determining membrane topology requires complementary experimental approaches:

  • Substituted cysteine accessibility method (SCAM):

    • Strategic introduction of cysteine residues throughout the protein

    • Treatment with membrane-permeable and -impermeable thiol reagents

    • Determination of modification sites by mass spectrometry

  • Reporter fusion approach:

    • Construction of fusion proteins with alkaline phosphatase (PhoA) and green fluorescent protein (GFP)

    • Expression in bacterial system

    • Measurement of reporter activity for orientation determination

  • Protease protection assays:

    • Reconstitution in proteoliposomes or expression in bacterial membranes

    • Limited proteolysis with proteases (trypsin, chymotrypsin)

    • Identification of protected fragments by mass spectrometry or western blotting

  • Fluorescence quenching analysis:

    • Introduction of environmentally sensitive fluorophores

    • Measurement of accessibility to membrane-impermeable quenchers

Each approach provides complementary information, with convergent results offering strong evidence for a particular topological model.

How can molecular dynamics simulations enhance understanding of mlr0776 function?

Molecular dynamics (MD) simulations offer insights into protein behavior in membrane environments:

  • Simulation system preparation:

    • Homology model construction based on related proteins

    • Embedding in explicit lipid bilayer (POPC/POPE mixture)

    • Solvation with water and appropriate counterions

    • Energy minimization and equilibration

  • Simulation protocols:

    • All-atom MD simulations (100-1000 ns)

    • Coarse-grained simulations for longer timescales

    • Analysis of protein stability, flexibility, and lipid interactions

  • Key measurements:

    • Root-mean-square deviation (RMSD) and fluctuation (RMSF)

    • Secondary structure stability

    • Lipid-protein interactions

    • Water permeation through potential channels

  • Advanced simulations:

    • Steered MD to simulate SMFS experiments

    • Free energy calculations for binding partner interactions

    • Umbrella sampling for energy landscapes

MD simulations can be validated against experimental SMFS data, providing a framework for understanding the mechanical unfolding properties observed in experimental force-distance curves .

What electrophysiological approaches can assess potential channel or transporter activity of mlr0776?

If mlr0776 functions as an ion channel or transporter, several electrophysiological techniques can be employed:

  • Planar lipid bilayer recordings:

    • Formation of painted or folded bilayers

    • Incorporation of purified mlr0776

    • Voltage-clamp recordings under symmetric and asymmetric conditions

    • Ion selectivity determination via ion substitution experiments

  • Patch-clamp methodology:

    • Heterologous expression in mammalian cells or oocytes

    • Whole-cell and single-channel recordings

    • Pharmacological characterization with potential inhibitors

    • Gating analysis under various voltage protocols

  • Solid-supported membrane (SSM)-based electrophysiology:

    • Suitable for transporters with low turnover rates

    • Adsorption of proteoliposomes to SSM

    • Measurement of transient currents upon substrate addition

    • Determination of substrate specificity and transport kinetics

  • Data analysis framework:

    • Single-channel conductance calculation

    • Open probability determination

    • Kinetic modeling of gating behavior

    • Transport stoichiometry assessment

These methodologies provide complementary information about potential transport or channel functions, which could be relevant for cellular processes during symbiosis.

How can researchers investigate potential conformational changes in mlr0776 during its functional cycle?

Understanding conformational dynamics requires specialized biophysical techniques:

  • Site-directed fluorescence labeling approach:

    • Introduction of cysteine residues at strategic positions

    • Labeling with environmentally sensitive fluorophores

    • Measurement of fluorescence changes upon substrate addition or voltage changes

    • FRET pairs for measuring distance changes

  • EPR spectroscopy methodology:

    • Spin-labeling of cysteine residues

    • Continuous wave EPR for mobility assessment

    • Double electron-electron resonance (DEER) for distance measurements

    • Analysis of conformational equilibria under different conditions

  • Hydrogen-deuterium exchange mass spectrometry:

    • Incubation of protein in D2O under various conditions

    • Quenching and pepsin digestion

    • LC-MS/MS analysis of deuterium incorporation

    • Identification of regions with altered solvent accessibility

  • Time-resolved structural methods:

    • Stopped-flow FRET or fluorescence

    • Rapid-freeze quench EPR

    • Time-resolved X-ray solution scattering

These techniques can reveal how the protein structure changes during function, potentially identifying conformational states critical for activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.