Recombinant Rhizobium loti UPF0314 protein mll5005 (mll5005)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Rhizobium loti UPF0314 protein mll5005 (mll5005) is a protein of unknown function (UPF0314) derived from the bacterium Rhizobium loti (also known as Mesorhizobium loti) strain MAFF303099 . M. loti is a Gram-negative soil bacterium known for its symbiotic relationship with legumes, particularly those of the Lotus genus . This symbiosis leads to nitrogen fixation, where the bacteria convert atmospheric nitrogen into ammonia, a form usable by plants .

Gene and Protein Characteristics

The protein is encoded by the gene mll5005 and is also referred to as UPF0314 protein mLl5005 . The protein sequence consists of 199 amino acids .

Role in Symbiosis and Nitrogen Fixation

M. loti has two distinct physiological states: a free-living state in the soil and a symbiotic nitrogen-fixing state within the nodules of its host legume . The symbiosis island in M. loti MAFF303099, a 610,975-bp DNA segment of the chromosome, contains 582 protein-encoding genes . Under symbiotic conditions, 74 proteins (8.7% of the total) are produced from this island, whereas only 22 proteins (1.4%) are produced during the free-living state .

Reactive Oxygen Species (ROS) Scavenging

M. loti employs various mechanisms to manage ROS during symbiotic interactions . Monofunctional catalases, such as KatE in M. loti, are stable enzymes that function across a wide pH range to detoxify hydrogen peroxide (H2O2) .

Rhizobial Exopolysaccharides

Exopolysaccharides (EPS) play a crucial role in rhizobial infection during symbiotic interactions . In Mesorhizobium-Lotus interactions, the symbiotic role of EPS is complex . Some EPS mutants of M. loti R7A show nodulation deficiencies on L. japonicus and L. corniculatus, while others form effective nodules .

Type III Secretion System (T3SS)

M. loti strains like MAFF303099 possess a T3SS . Deletion of T3SS in MAFF303099 does not affect symbiotic performance with L. japonicus but modulates nodulation capacity with other Lotus species . Effectors like Mlr6361 can negatively affect symbiosis with certain hosts, potentially acting as PAMP or virulence factors .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mll5005; UPF0314 protein mll5005
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Target Names
mll5005
Target Protein Sequence
MSKPAADDGYSAYEDSWRMGLLLVLGLLIFQAGALYGMGRTPICTCGYVKLWHGVVNSSE NSQHIADWYTFSHIIHGFLFYALVRFLFPRSPIGLRLAFAVLIEGGWELLENSPFIIDRY RAGTISLDYYGDSIINSVSDTLAMVLGFVMARRLPIWVIVSLAILFELGTGYLIRDNLTL NVIMLLHPFEAIKQWQSGI
Uniprot No.

Target Background

Database Links

KEGG: mlo:mll5005

STRING: 266835.mll5005

Protein Families
UPF0314 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage and handling conditions for recombinant mll5005?

ParameterRecommendation
FormLyophilized powder
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Long-term storage-20°C/-80°C with 5-50% glycerol (50% recommended)
Working storage4°C for up to one week
BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Special considerationsAvoid repeated freeze-thaw cycles; centrifuge vial before opening

For optimal results, aliquot the reconstituted protein to avoid repeated freeze-thaw cycles which can compromise protein integrity .

How can I design experiments to determine the function of UPF0314 protein mll5005?

Since mll5005 is a protein of unknown function, a systematic approach is required:

  • Sequence-based predictions: Perform bioinformatic analysis to identify conserved domains and motifs that might suggest function.

  • Gene knockout studies: Create knockout mutants in Rhizobium loti and evaluate phenotypic changes, particularly in symbiotic capabilities with Lotus plants.

  • Localization experiments: Use fluorescently-tagged versions to determine subcellular localization during different stages of the bacterial life cycle and symbiosis.

  • Expression profiling: Analyze expression patterns during different growth phases and symbiotic stages using RT-qPCR or RNA-seq.

  • Interactome analysis: Identify protein interaction partners using techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or pull-down assays.

  • Structural studies: Determine the protein's structure through X-ray crystallography or cryo-electron microscopy to gain insights into potential functions.

The integration of these approaches has proven effective in elucidating the function of previously uncharacterized proteins in bacterial systems .

What experimental design is recommended for studying mll5005's potential role in nodulation?

Based on established protocols in Rhizobium-legume symbiosis research, the following experimental design is recommended:

Stage 1: Phenotypic Characterization

  • Generate an mll5005 deletion mutant in Rhizobium loti

  • Compare nodulation efficiency between wild-type and mutant strains on Lotus japonicus and other Lotus species

  • Quantify nodule number, size, morphology, and nitrogen fixation capacity

Stage 2: Competitive Nodulation Assays

  • Conduct co-inoculation experiments with wild-type and mutant strains (1:1 ratio)

  • Determine nodule occupancy using strain-specific markers or antibiotic resistance

  • This approach is critical as many symbiotic phenotypes only manifest under competitive conditions

Stage 3: Plant Response Analysis

  • Monitor plant defense responses (ROS production, PR protein expression)

  • Compare infection thread formation and progression

  • Analyze plant gene expression patterns in response to wild-type versus mutant strains

Stage 4: Protein Localization During Symbiosis

  • Create fluorescently-tagged mll5005 constructs

  • Track protein localization during root colonization, infection thread formation, and bacteroid differentiation

  • Co-localize with known symbiosis markers

This multi-stage approach allows for comprehensive characterization of mll5005's potential role in the symbiotic process.

How does mll5005 compare to other proteins in Rhizobium loti and related species?

While the specific function of mll5005 remains uncharacterized, contextualizing it within the broader landscape of Rhizobium/Mesorhizobium proteins provides valuable insights:

  • Structural comparison: The mll5005 protein belongs to the UPF0314 family, while Rhizobium loti also contains other UPF proteins such as UPF0339 protein Msl4696, suggesting multiple uncharacterized protein families with potentially related functions .

  • Genomic context: The M. loti genome contains numerous proteins involved in symbiosis, including secretion system components, nodulation proteins, and membrane-associated factors. Understanding mll5005's position in this genetic landscape can provide functional clues.

  • Evolutionary conservation: Comparative genomic analysis across Rhizobium species can reveal the conservation pattern of mll5005 homologs, which may correlate with host specificity patterns. For instance, M. loti strains are divided into host-range groupings (Group I strains nodulate L. corniculatus and L. japonicus ecotype Gifu, while Group II strains have broader host ranges) .

Researchers should use tools like BLAST, Clustal Omega, and phylogenetic analysis to place mll5005 in its evolutionary context.

What is the relationship between mll5005 and the symbiotic capabilities of Rhizobium loti?

While direct evidence for mll5005's role in symbiosis is not explicitly described in current research, several contextual factors are relevant:

  • Symbiotic signaling: Rhizobium-legume symbiosis involves complex molecular signaling mediated by bacterial proteins. NodD proteins recognize plant-derived flavonoids and activate genes required for nodulation factor synthesis. These signaling pathways are critical for host specificity .

  • Host defense evasion: Successful symbiosis requires rhizobia to evade or suppress host defense responses. Membrane-associated proteins often play crucial roles in this process by protecting bacteria from reactive oxygen species (ROS) produced by the plant .

  • Secretion systems: Mesorhizobium loti utilizes Type III secretion systems (T3SS) for host-specific modulation of symbiotic efficiency. Membrane-associated proteins like mll5005 may interact with these systems or contribute to their assembly or regulation .

  • Host range determination: Different M. loti strains exhibit varying host ranges, which correlate with distinct symbiosis island lineages and unique gene complements. The presence or absence of proteins like mll5005 may contribute to these host specificity patterns .

Experimental approaches to investigate mll5005's potential role in these processes would involve gene knockout studies combined with detailed phenotypic analysis of symbiotic interactions.

What analytical approaches can be used to study potential post-translational modifications of mll5005?

Post-translational modifications (PTMs) often regulate protein function and can be crucial for membrane-associated proteins. The following analytical approaches are recommended for studying mll5005 PTMs:

Mass Spectrometry-Based Approaches:

  • Bottom-up proteomics: Enzyme digestion followed by LC-MS/MS to identify modification sites

  • Top-down proteomics: Analysis of intact protein to preserve PTM stoichiometry

  • Targeted MS: Multiple reaction monitoring (MRM) for quantitative analysis of specific modifications

Enrichment Strategies:

  • Phosphoproteomics: IMAC or titanium dioxide enrichment for phosphorylation sites

  • Glycoproteomics: Lectin affinity chromatography for glycosylation analysis

Functional Validation:

  • Site-directed mutagenesis: Modify potential PTM sites and analyze functional consequences

  • In vitro modification: Enzymatic assays to confirm modifiability of specific residues

These approaches have been successfully applied to characterize PTMs in bacterial membrane proteins and provide insights into their functional regulation.

How can I design experiments to analyze mll5005's potential role in experimental design contexts such as factorial and within-subjects designs?

When investigating mll5005's function using complex experimental designs, consider the following approaches:

For Factorial Design Experiments:

  • Factor selection: Design a full factorial experiment with factors such as:

    • Genetic background (wild-type vs. mll5005 mutant)

    • Host plant species (different Lotus species)

    • Environmental conditions (various stressors)

  • Example design: A 2×3×2 factorial design examining:

    • Bacterial strain (wild-type vs. Δmll5005)

    • Host plant (L. japonicus, L. corniculatus, L. pedunculatus)

    • Environmental condition (normal vs. stressed)

This approach allows for the assessment of interaction effects between factors, which may reveal conditional functions of mll5005 .

For Within-Subjects Design:
When studying plant responses to different bacterial strains:

  • Split-root systems: Inoculate different roots of the same plant with wild-type and mutant strains

  • Time-course experiments: Monitor changes in gene expression or protein levels at different time points following inoculation

Sample Size Considerations:
For proper statistical power, sample size determination should be based on:

  • Expected effect size (often smaller for molecular phenotypes)

  • Desired statistical power (typically 0.8 or higher)

  • Appropriate correction for multiple testing

Using factorial designs increases statistical efficiency and reduces the number of experimental units needed compared to one-factor-at-a-time approaches .

What methods are most effective for optimizing recombinant mll5005 expression and purification?

Optimizing expression and purification of membrane-associated proteins like mll5005 requires specialized approaches:

Expression Optimization:

  • Host selection: While E. coli is commonly used , consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Induction conditions: Test various temperatures (16-30°C), inducer concentrations, and induction times

  • Fusion partners: N-terminal fusions beyond the His-tag (such as MBP or SUMO) may improve solubility

  • Media optimization: Test enriched media formulations to enhance yield

Purification Strategy:

  • Membrane extraction: Use mild detergents like DDM, LDAO, or FC-12 for efficient extraction

  • Two-step purification: Combine IMAC (using the His-tag) with size exclusion chromatography

  • Buffer optimization: Screen different buffers, pH values, and salt concentrations to maintain stability

  • Quality assessment: Verify purity by SDS-PAGE (>90% is standard) and homogeneity by dynamic light scattering

These approaches have proven effective for other membrane-associated bacterial proteins and should be applicable to mll5005.

How can I validate the structural integrity and functionality of purified recombinant mll5005?

For proteins of unknown function like mll5005, structural and functional validation requires multiple complementary approaches:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy: Verify secondary structure content

  • Thermal shift assays: Measure protein stability and proper folding

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Confirm proper oligomeric state

Functional Validation Approaches:

  • Membrane incorporation assays: Test integration into liposomes or nanodiscs

  • Complementation studies: Express the recombinant protein in mll5005-deficient bacteria to rescue potential phenotypes

  • Binding studies: Identify potential interaction partners using pull-down assays or surface plasmon resonance

Given that UPF0314 proteins have unknown functions, validation may require hypothesis-driven experiments based on bioinformatic predictions or comparative analysis with structurally similar proteins.

What are the primary challenges in studying membrane-associated proteins like mll5005?

Membrane-associated proteins present several unique research challenges:

Technical Challenges:

  • Solubility and stability: Maintaining native structure outside the membrane environment

  • Expression yields: Typically lower than soluble proteins (often <1 mg/L culture)

  • Purification complexity: Requires specialized detergents or amphipols

  • Structural determination: More difficult to crystallize or analyze by traditional methods

Functional Characterization Challenges:

  • Context-dependent activity: May only function properly in specific membrane environments

  • Complex protein-lipid interactions: Function may depend on specific lipid compositions

  • Reconstitution requirements: Testing function often requires complex membrane-mimetic systems

Solutions and Approaches:

  • Advanced expression systems: Consider cell-free expression systems or specialized hosts

  • Alternative structural methods: Cryo-EM is increasingly useful for membrane protein structures

  • Native membrane isolation: Analyze the protein in its native bacterial membrane when possible

  • Computational predictions: Use advanced bioinformatics to guide experimental design

What future research directions might help elucidate the function of mll5005 in Rhizobium-legume symbiosis?

Based on current knowledge gaps, several promising research directions emerge:

Genomic and Evolutionary Approaches:

  • Comparative genomics: Analyze mll5005 conservation across Rhizobium strains with different host ranges

  • Synteny analysis: Examine genomic context for clues about functional networks

  • Convergent evolution study: Compare with functionally similar proteins in other nitrogen-fixing bacteria

Systems Biology Approaches:

  • Interactome mapping: Comprehensive identification of protein-protein interactions

  • Metabolomics integration: Link mll5005 to metabolic pathways altered during symbiosis

  • Multi-omics data integration: Combine transcriptomics, proteomics, and metabolomics data

Advanced Functional Characterization:

  • CRISPR interference: Use CRISPRi for fine-tuned regulation rather than complete knockouts

  • Single-cell analysis: Examine cell-to-cell variability in expression and localization

  • In situ structural studies: Examine the protein structure within the bacterial membrane

Translational Applications:

  • Engineering improved symbiosis: Modify mll5005 to enhance nitrogen fixation efficiency

  • Cross-species functionality: Test if mll5005 variants from different Rhizobium species alter host specificity

  • Synthetic biology approaches: Design minimal systems to test hypothesized functions

These directions build upon the growing knowledge of symbiosis islands in Rhizobium species and their role in host-range determination .

How should I approach data analysis when studying potential functions of mll5005?

When analyzing data from experiments investigating mll5005 function, consider these methodological approaches:

Statistical Considerations:

  • Appropriate controls: Include both positive controls (known functional proteins) and negative controls (empty vector)

  • Multiple testing correction: Apply FDR or Bonferroni correction when performing multiple comparisons

  • Effect size reporting: Report not only p-values but also effect sizes and confidence intervals

Experimental Design Analysis:

  • Factorial analysis: Use ANOVA or mixed-effects models for factorial designs examining interactions between genetic background, environmental conditions, and host species

  • Repeated measures analysis: For time-course experiments, use repeated measures ANOVA or linear mixed models

  • Non-parametric alternatives: Consider non-parametric tests when assumptions of normality are violated

Data Integration Approaches:

  • Meta-analysis: Combine results across multiple experiments

  • Bayesian analysis: Incorporate prior knowledge and update probabilities as new data emerges

  • Network analysis: Place findings in the context of known protein-protein interaction networks

These analytical approaches will help distinguish genuine biological effects from experimental noise and identify the true functional role of mll5005.

What protein leverage considerations should be taken into account when designing experiments with mll5005?

While the concept of protein leverage is typically applied to dietary protein studies , the principle can be extended to experimental design for studying bacterial proteins like mll5005:

Experimental Considerations:

  • Expression level control: Design experiments that account for varying expression levels of mll5005, as over-expression may have different effects than physiological levels

  • Stoichiometric balance: Consider the ratio of mll5005 to potential interaction partners, as imbalances may affect results

  • Competitive dynamics: When studying symbiotic competitiveness, consider how the presence/absence of mll5005 affects the competitive balance with other bacterial strains

Physiological Context:

These considerations help ensure that experimental findings reflect the genuine biological role of mll5005 rather than artifacts of experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.