Recombinant Rhizobium meliloti Aquaporin Z 1 (aqpZ1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

aqpZ1 belongs to the aquaporin family, which regulates water and small solute transport across membranes. While Rhizobium meliloti’s aqpZ1 has not been studied in depth, structural and functional parallels with E. coli Aquaporin Z (AqpZ) suggest it may exhibit water-selective channel activity. Key insights include:

Symbiotic and Environmental Roles

  • Plant-Microbe Interactions: Aquaporins in Rhizobium may facilitate water/nutrient exchange during symbiosis with legumes, as seen in arbuscular mycorrhizae .

  • Stress Tolerance: aqpZ1 could mediate osmotic stress responses, though direct evidence remains limited.

Research Applications and Experimental Uses

The recombinant aqpZ1 protein is utilized in diverse experimental contexts:

ApplicationMethodologyPurpose
Structural AnalysisX-ray crystallography, cryo-EMElucidate pore architecture and substrate selectivity
Functional AssaysOsmotic swelling, stopped-flow spectroscopyMeasure water permeability and ion exclusion
Antibody DevelopmentELISA, Western blottingDetect aqpZ1 in Rhizobium or plant-microbe co-cultures
Interaction StudiesCo-IP, pull-down assaysIdentify protein partners in symbiotic pathways

Comparative Analysis with Other Aquaporins

aqpZ1 differs from aquaglyceroporins (e.g., S. meliloti AqpS) in substrate specificity:

PropertyaqpZ1AqpS (S. meliloti)
Primary FunctionWater transportMethylarsenate (MAs(V)) efflux
Selectivity FilterHydrophobic residues (e.g., Ala, Val)Val177 allows anion passage
Role in StressOsmotic adaptationArsenic resistance

Future Research Directions

  1. Symbiotic Function: Investigate aqpZ1’s role in Rhizobium-legume interactions using knockout mutants.

  2. Stress Adaptation: Test its involvement in drought or osmotic stress tolerance.

  3. Structural Determination: Solve its X-ray structure to confirm water selectivity.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize developing the requested tag.
Synonyms
aqpZ1; R02172; SMc01870; Aquaporin Z 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
aqpZ1
Target Protein Sequence
MFRKLSVEFLGTFWLVLGGCGSAVLAAAFPEVGIGLLGVSFAFGLTVLTMAYAVGGISGGHFNPAVSVGLAVAGRMPPASLVGYILAQVTGAIAAAAVLYVIASGKADFQLGGFAANGYGEHSPGGYSLTAALVTEVVMTAFFLLIILGSTHSRVPVGFAPIAIGLGLTLIHLVSIPVTNTSVNPARSTGQALFVGDWAISQLWLFWVAPLIGAVIAGIVWKIVGDDS
Uniprot No.

Target Background

Function
Aquaporin Z 1 (aqpZ1) is a channel protein that facilitates the osmotically driven movement of water in both directions. It plays a crucial role in osmoregulation and maintaining cell turgor during volume expansion in rapidly growing cells. AqpZ1 mediates the rapid entry or exit of water in response to sudden changes in osmolarity.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium meliloti Aquaporin Z 1 (aqpZ1) and what is its primary function in bacterial systems?

Rhizobium meliloti Aquaporin Z 1 (aqpZ1) is a transmembrane protein belonging to the aquaporin family that facilitates the movement of water and specific solutes across the cell membrane of R. meliloti (also known as Sinorhizobium meliloti). Aquaporins are channel proteins that form pores in the membrane of biological cells, primarily facilitating rapid water movement in response to osmotic gradients. While the specific characterization of aqpZ1 is still emerging, research on related aquaporins in R. meliloti demonstrates their importance in osmoregulation and potentially in transport of other compounds including metalloids . The aqpZ1 gene is identified in genomic databases with the identifier SMc01870 according to both KEGG and STRING classifications . Unlike conventional water-specific aquaporins, evidence from related R. meliloti aquaporins suggests these proteins may have evolved specialized functions related to environmental adaptation and stress response in soil environments where this nitrogen-fixing bacterium naturally resides .

What expression systems are most effective for producing recombinant aqpZ1 from Rhizobium meliloti?

The E. coli expression system is the predominant platform for producing recombinant Rhizobium meliloti aqpZ1, with E. coli BL21(DE3) being particularly effective for membrane protein expression . While specific optimization parameters for aqpZ1 production require further research, insights from related aquaporin studies suggest several key considerations. Successful expression typically employs induction with IPTG at concentrations around 0.5 mM, with reduced temperatures (approximately 25°C) and extended induction periods (20 hours) to minimize inclusion body formation while maximizing functional protein yield . The expression vector selection is critical, with constructs containing strong but controllable promoters like T7 being advantageous for membrane protein expression. Additionally, co-expression with molecular chaperones may enhance proper folding and membrane insertion of aqpZ1. Researchers may need to empirically determine strain-specific optimization parameters, as membrane protein expression efficiency can vary considerably between individual proteins even within the same family .

What purification approaches yield highest functional recovery of recombinant aqpZ1?

A multi-step purification approach is necessary for obtaining high-quality recombinant aqpZ1 suitable for functional and structural studies. The initial critical step involves membrane protein solubilization using appropriate detergents, with zwitterionic detergents like CHAPS [(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate proving particularly effective for aquaporin extraction while preserving functional integrity . Following solubilization, affinity chromatography represents the primary purification method, typically utilizing histidine-tagged constructs bound to nickel or cobalt resins that allow specific capture of the target protein . Subsequent purification often employs size-exclusion chromatography to separate protein aggregates and remove residual contaminants. Throughout the purification process, buffer composition is crucial, with glycerol (10-15%) often included to stabilize the protein, along with optimized salt concentrations to maintain protein solubility without disrupting detergent micelles. For functional studies, researchers should verify protein integrity through techniques like circular dichroism spectroscopy to confirm proper secondary structure composition before proceeding to functional reconstitution experiments .

How does aqpZ1 compare structurally and functionally to other aquaporins in Rhizobium meliloti?

Rhizobium meliloti contains multiple aquaporin variants with distinct structural features and substrate specificities. While detailed comparative studies between aqpZ1 and other R. meliloti aquaporins remain limited, available research on AqpS provides valuable insights into potential differences. AqpS represents an unusual aquaglyceroporin capable of conducting both methylarsenite (MAs(III)) and methylarsenate (MAs(V)) . Unlike most bacterial aquaporins including E. coli GlpF which poorly conduct MAs(V) anions, AqpS's distinct selectivity filter contains a nonpolar Val177 in place of the charged arginine residue typically found in other aquaporins . This substitution enables AqpS to transport negatively charged MAs(V), representing a unique adaptation. While the specific selectivity filter composition of aqpZ1 requires further characterization, genomic analysis suggests potential structural differences from AqpS that might confer different substrate preferences or transport kinetics. These molecular distinctions likely reflect evolutionary adaptations to varying environmental challenges, with AqpS apparently specialized for metalloid transport as part of arsenic resistance pathways .

What methodological approaches are most effective for analyzing substrate specificity of recombinant aqpZ1?

Comprehensive analysis of aqpZ1 substrate specificity requires multiple complementary methodologies. Liposome-based transport assays represent the gold standard, where purified aqpZ1 is reconstituted into proteoliposomes and substrate transport is measured through various detection methods . For water permeability, stopped-flow spectroscopy with osmotic gradients provides quantitative measurement of water flux rates. For potential metalloid transport (similar to AqpS), researchers should employ isotopically labeled compounds (e.g., 73As-labeled arsenic species) coupled with ICP-MS detection to precisely quantify transport rates . Site-directed mutagenesis targeting predicted selectivity filter residues offers mechanistic insights, particularly when comparing transport kinetics between wild-type and mutant proteins. Computational approaches, including molecular dynamics simulations examining substrate interactions with the channel pore, complement experimental data. Additionally, in vivo complementation assays using bacterial strains deficient in specific transport pathways can validate substrate specificity in biological contexts. A particularly informative approach involves comparing aqpZ1 transport properties with those of AqpS, since the latter's unusual ability to transport methylarsenate anions through its unique Val177-containing selectivity filter provides a valuable reference point for structure-function relationships in R. meliloti aquaporins .

What are the challenges and solutions in reconstituting functional aqpZ1 into membrane systems for transport studies?

Reconstituting functional aqpZ1 into artificial membrane systems presents several significant challenges requiring methodological refinements. The primary challenge involves maintaining protein stability during the transition from detergent micelles to lipid bilayers. Researchers should empirically determine the optimal detergent removal method, with biobeads adsorption typically providing more controlled detergent extraction than dialysis for aquaporins . The lipid composition dramatically influences aquaporin function, with E. coli polar lipids or synthetic mixtures containing phosphatidylcholine and phosphatidylglycerol in defined ratios often yielding superior results. Protein-to-lipid ratios require careful optimization, typically starting with 1:100 weight ratios and adjusting based on preliminary functional assessments. Dynamic light scattering should be employed to characterize proteoliposome size distributions, with homogeneous populations around 100-200 nm diameter generally indicating successful reconstitution . The reconstitution buffer composition significantly impacts both reconstitution efficiency and subsequent transport measurements, with pH, ionic strength, and osmolyte concentrations requiring systematic optimization. Researchers should verify successful incorporation and orientation using protease protection assays or antibody-based techniques targeting exposed epitopes. For transport measurements, consistent proteoliposome preparation is essential, with technical replicates from independent reconstitutions necessary to confirm reproducibility of transport kinetics measurements.

How can researchers utilize site-directed mutagenesis to investigate structure-function relationships in aqpZ1?

Site-directed mutagenesis represents a powerful approach for elucidating critical structural determinants of aqpZ1 function through systematic amino acid substitutions. Based on insights from related aquaporins like AqpS, several key regions merit investigation. The selectivity filter (ar/R constriction) represents a primary target, particularly examining how mutations that alter pore diameter or charge distribution affect substrate specificity. The unusual Val177 in AqpS enables methylarsenate anion transport; therefore, identifying and mutating the equivalent position in aqpZ1 to charged residues could reveal whether aqpZ1 shares this unusual anion conductance capability . The NPA (asparagine-proline-alanine) motifs common in aquaporins are critical for water orientation and proton exclusion; conservative mutations (e.g., asparagine to glutamine) can help define their role in aqpZ1 function. Researchers should employ a combined electrophysiological and spectroscopic approach to characterize mutants, with stopped-flow measurements quantifying water permeability changes and isotope-labeled solute transport assays assessing alterations in substrate specificity. Additionally, cysteine-scanning mutagenesis combined with accessibility assays using sulfhydryl reagents can map the aqueous pore structure in detail. For comprehensive structure-function analysis, researchers should express and characterize multiple mutants simultaneously, creating systematic substitution libraries focusing on conserved residues identified through sequence alignments with functionally characterized aquaporins like AqpS and E. coli GlpF .

What role might aqpZ1 play in Rhizobium meliloti's adaptation to environmental stresses in the rhizosphere?

Rhizobium meliloti's environmental adaptations likely involve aqpZ1 in multiple stress response pathways relevant to its role as a soil bacterium and plant symbiont. During osmotic stress fluctuations common in soil environments, aqpZ1 likely regulates cellular water content through rapid water flux in response to changing external osmolarity. In drought conditions, controlled water efflux mediated by aquaporins may concentrate compatible solutes internally, enhancing bacterial survival. Research on related R. meliloti aquaporins suggests potential roles in toxic metalloid detoxification pathways, similar to AqpS involvement in arsenical compound transport . The aqpZ1 may participate in complex arsenical detoxification mechanisms where toxic arsenite enters cells, undergoes enzymatic transformation to less toxic forms, then exits via aquaporins—representing a complete detoxification cycle . During plant-microbe interactions in the rhizosphere, aqpZ1 might facilitate adaptation to the specialized chemical environment created by plant root exudates. Evidence that biotin availability influences R. meliloti growth in the alfalfa rhizosphere suggests intricate nutrient-dependent adaptation mechanisms in which membrane transporters like aqpZ1 may play supporting roles . Additionally, aquaporins may indirectly influence nitrogen fixation efficiency by maintaining optimal cellular water balance during nodulation and subsequent symbiotic processes. Research examining aqpZ1 expression patterns under varying environmental conditions, particularly in plant-associated states versus free-living conditions, would provide valuable insights into its role in R. meliloti's ecological adaptations.

What computational approaches can predict aqpZ1 transport properties and guide experimental design?

Computational modeling provides powerful approaches for predicting aqpZ1 transport properties and generating testable hypotheses to guide experimental design. Homology modeling represents the initial approach, utilizing crystallographic structures of related aquaporins (particularly E. coli GlpF and AqpS) as templates to predict aqpZ1's three-dimensional structure . Researchers should employ multiple modeling algorithms with subsequent quality assessment using tools like PROCHECK and verify predictions through limited proteolysis or epitope mapping. Molecular dynamics (MD) simulations offer insights into water and solute permeation mechanisms by calculating potential of mean force profiles for different substrates, revealing energy barriers encountered during transport. Particularly relevant is the analysis of selectivity filter interactions, examining how the aqpZ1 equivalent of Val177 in AqpS might influence substrate selectivity . Quantum mechanics/molecular mechanics (QM/MM) calculations provide higher resolution analysis of critical interactions in the selectivity filter region. For broader functional predictions, researchers should perform comprehensive sequence analysis using hidden Markov models to identify conserved motifs across taxonomically diverse aquaporins with known functions. Structure-based virtual screening can identify potential inhibitors or substrates by docking compound libraries against the predicted channel structure. These computational predictions should generate specific experimental hypotheses, such as predicted transport rates for specific substrates or effects of point mutations on channel function, creating an iterative cycle where experimental results refine computational models.

How can recombinant aqpZ1 be utilized in studying plant-microbe interactions involving Rhizobium meliloti?

Recombinant aqpZ1 offers multiple applications for investigating the complex symbiotic relationship between Rhizobium meliloti and leguminous plants like alfalfa. Researchers can create R. meliloti strains with modified aqpZ1 expression levels through gene knockout, complementation, or overexpression approaches to assess its role in colonization efficiency, competitiveness, and survival in the rhizosphere. Previous research demonstrated that R. meliloti growth in the alfalfa rhizosphere is influenced by biotin availability, suggesting the importance of nutritional factors in plant-microbe interactions . Similarly, manipulating aqpZ1 expression could reveal its contribution to bacterial adaptation in the specialized rhizosphere environment. Fluorescently tagged aqpZ1 constructs enable in vivo localization studies examining protein distribution patterns during different stages of symbiosis formation. For mechanistic investigations, aqpZ1 knockout strains complemented with site-directed mutants can help identify channel features essential for symbiotic efficiency. Researchers can also examine aqpZ1 expression patterns under varying rhizosphere conditions using reporter gene fusions to identify environmental factors regulating its expression. Additionally, proteomic approaches comparing wild-type and aqpZ1-modified strains during plant colonization can reveal associated protein networks involved in symbiotic interactions. Since Rhizobia are critical nitrogen-fixing symbionts, understanding aqpZ1's potential role in this process may provide insights for enhancing agricultural productivity through optimized plant-microbe interactions .

What protocols yield most reliable functional data when comparing wild-type versus mutant aqpZ1 variants?

Generating reliable comparative functional data between wild-type and mutant aqpZ1 variants requires rigorous methodological approaches addressing multiple potential confounding factors. Researchers should employ isogenic expression systems with identical vector backbones, promoters, and affinity tags to eliminate expression-related variables. Quantitative Western blotting with calibrated standards must verify equivalent protein expression levels across variants. For membrane proteins like aqpZ1, proper localization assessment using fractionation procedures or fluorescent tagging approaches is essential to confirm comparable membrane integration efficiency. Purification protocols should be identical across variants, with rigorous quality control including size-exclusion chromatography profiles and circular dichroism spectroscopy confirming comparable structural integrity . For functional comparisons in proteoliposome systems, researchers must ensure identical protein-to-lipid ratios, consistent vesicle size distributions (verified by dynamic light scattering), and equivalent protein orientation in the membrane (assessed by protease protection assays) . Water transport measurements should employ stopped-flow spectroscopy with precisely controlled osmotic gradients, collecting sufficient technical replicates for statistical validation. For substrate transport, isotope-labeled compounds with sensitive detection methods provide quantitative comparative data. Temperature dependence measurements calculating activation energy can reveal mechanistic differences between variants that might not be apparent from single-temperature measurements. Additionally, researchers should perform stability assessments through thermal denaturation or limited proteolysis to identify potential mutations affecting channel stability rather than direct transport function.

What are the key experimental controls necessary when evaluating aqpZ1's role in metalloid transport mechanisms?

Rigorous experimental design for evaluating aqpZ1's potential role in metalloid transport requires comprehensive controls addressing multiple aspects of the transport pathway. Researchers must first establish baseline metalloid sensitivity of the experimental system using wild-type, aqpZ1 knockout, and complemented strains across a concentration series of relevant metalloids (arsenite, arsenate, methylated arsenicals) . Control experiments should include parallel testing of well-characterized aquaporins with known metalloid transport properties, such as E. coli GlpF (which conducts MAs(III) but not MAs(V)) and R. meliloti AqpS (which conducts both species) . For in vitro transport studies, negative controls using protein-free liposomes and liposomes containing unrelated membrane proteins are essential to distinguish specific transport from non-specific leakage. Researchers must verify metalloid species stability during experiments, as interconversion between oxidation states can confound interpretation; HPLC-ICP-MS analysis before and after transport assays can confirm species identity. Competition assays using excess unlabeled metalloids should demonstrate transport saturation kinetics characteristic of channel-mediated processes. Bidirectional transport assays with inside-out versus right-side-out vesicles can reveal potential transport asymmetry. Specific inhibitor controls using known aquaporin blockers like mercury compounds (with and without reducing agent reversal) provide further confirmation of channel-mediated transport. Additionally, researchers should conduct parallel experiments examining how enzymes involved in metalloid metabolism (like ArsH, which oxidizes MAs(III) to MAs(V)) interact with aqpZ1-mediated transport to understand the complete detoxification pathway context .

How can researchers effectively compare the transport properties of aqpZ1 with other bacterial aquaporins?

Effective comparative analysis of aqpZ1 transport properties relative to other bacterial aquaporins requires systematized approaches that minimize methodological variables. Researchers should develop standardized expression and purification protocols applicable across multiple aquaporin variants, ideally expressing all target proteins in the same host system with identical purification strategies . For functional comparison, proteoliposome preparation must maintain consistent lipid composition, protein-to-lipid ratios, and vesicle size distributions across all tested aquaporins. Water permeability measurements should employ standardized stopped-flow protocols with identical osmotic gradients, data collection parameters, and curve-fitting approaches. For solute transport, researchers should develop a comprehensive substrate panel including water, glycerol, metalloids like arsenite and arsenate, methylated arsenicals, and other physiologically relevant molecules to generate complete permeability profiles for each aquaporin . Transport data should be normalized to protein content with correction factors for variation in successful membrane incorporation. Structural correlations require alignment of selectivity filter residues across compared aquaporins, with particular attention to positions equivalent to Val177 in AqpS, which enables its unusual ability to conduct methylarsenate anions . Researchers should also measure pH and temperature dependence of transport activities, as these can reveal mechanistic differences between otherwise similar channels. For physiological relevance, complementation studies in appropriate knockout backgrounds can compare the ability of different aquaporins to restore wild-type phenotypes under various stress conditions. These systematic approaches enable reliable comparison of aqpZ1 with functionally characterized aquaporins like E. coli AqpZ, GlpF, and R. meliloti AqpS.

What techniques can quantify the effects of environmental factors on aqpZ1 expression and function in Rhizobium meliloti?

Quantifying environmental influences on aqpZ1 expression and function requires integrating molecular, biochemical, and physiological methodologies. At the transcriptional level, quantitative RT-PCR provides precise measurement of aqpZ1 mRNA abundance under varying conditions including osmotic stress, pH changes, nutrient limitation, plant root exudate exposure, and presence of toxic metalloids . For higher throughput analysis, researchers can employ transcriptomic approaches (RNA-seq) to position aqpZ1 regulation within global gene expression networks responsive to environmental stimuli. Promoter-reporter fusions (using fluorescent proteins or luciferase) enable real-time monitoring of aqpZ1 transcriptional activity in living cells responding to environmental changes. At the protein level, quantitative Western blotting with specific antibodies or epitope-tagged constructs can track aqpZ1 protein abundance, while pulse-chase experiments reveal protein turnover rates under different conditions. For functional analysis, researchers can develop whole-cell swelling assays responsive to osmotic challenges that indirectly measure aquaporin activity. In vitro transport assays using membrane vesicles isolated from cells grown under different conditions can directly quantify how environmental factors affect channel activity. Additionally, researchers should investigate post-translational modifications like phosphorylation that might regulate aqpZ1 function using phosphoproteomic approaches. For understanding ecological relevance, competition experiments between wild-type and aqpZ1-deficient strains under defined environmental conditions can reveal fitness effects. These multi-level analytical approaches can establish how aqpZ1 participates in R. meliloti's adaptation to changing rhizosphere conditions, potentially including roles in plant symbiosis, drought resistance, and detoxification pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.