Recombinant Rhizobium meliloti Aquaporin Z 2 (aqpZ2)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant AqpZ2 (UniProt ID: Q92ZW9) is a 232-amino acid protein expressed in Escherichia coli with an N-terminal His tag for purification . Key features include:

PropertyDescription
Gene NameaqpZ2
SynonymsRA0329; SMa0627
Protein LengthFull-length (1–232 aa)
Expression HostE. coli
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Insights

AqpZ2 exhibits high water permeability and strict selectivity:

  • Water Transport: Conducts water at rates sixfold higher than E. coli glycerol facilitator GlpF .

  • Substrate Exclusion: Negligible permeability to glycerol, ions, or small solutes due to steric and electrostatic barriers .

  • Osmotic Role: Critical for cell volume regulation in Rhizobium meliloti under osmotic stress .

Comparative Analysis with Other Aquaporins

FeatureAqpZ2 (Rhizobium meliloti)AqpZ (E. coli)
Water PermeabilityHighModerate
Glycerol TransportNoNo
Structural StabilityEnhanced by trehalose bufferLess stable in detergents

A. Biochemical Studies

  • Reconstitution: Requires detergent removal and stabilization with glycerol (50% final concentration) .

  • Mutagenesis: Used to probe pore architecture and selectivity mechanisms .

B. Autoimmunity Research

AqpZ2 shares structural homology with human AQP4, implicated in neuromyelitis optica (NMO). Cross-reactive antibodies against AqpZ2 and AQP4 suggest a role in autoimmune trigger mechanisms .

A. Expression and Purification

  • Vector: pET-based system in E. coli .

  • Purification: Immobilized metal affinity chromatography (IMAC) via His tag .

  • Yield: ~0.1–1.0 mg/mL post-reconstitution .

B. Stability Considerations

  • Storage: -20°C/-80°C (avoid freeze-thaw cycles) .

  • Buffer: Tris/PBS with trehalose to prevent aggregation .

Comparative Genomic Insights

AqpZ2 is phylogenetically distinct from other bacterial aquaporins:

  • Agrobacterium Fabrum AqpZ2: Shares 85% sequence identity but differs in loop regions affecting substrate specificity .

  • Rhizobium meliloti Homologs: Part of a gene cluster (e.g., rkpGHI-J) involved in polysaccharide synthesis and symbiosis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
aqpZ2; RA0329; SMa0627; Aquaporin Z 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
aqpZ2
Target Protein Sequence
MFKKLCAEFLGTCWLVLGGCGSAVLASAFPQVGIGLLGVSFAFGLTVLTMAYTVGGISGGHFNPAVSLGLAVAGRVPAASLVSYVIAQVAGAIIAAAVLYVIATGKADFQLGSFAANGYGEHSPGGYSLTAALVTEVVMTFFFLIIILGSTHRRVPAGFAPIAIGLALTLIHLVSIPVTNTSVNPARSTGQALFVGGWALSQLWLFWIAPLFGAAIAGIVWKSVGEEFRPVD
Uniprot No.

Target Background

Function
Aquaporin Z 2 (aqpZ2) is a channel that facilitates the osmotically driven movement of water in both directions. It plays a crucial role in osmoregulation and maintaining cell turgor during volume expansion in rapidly growing cells. It mediates rapid water entry or exit in response to sudden changes in osmolarity.
Database Links

KEGG: sme:SMa0627

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium meliloti Aquaporin Z 2 and what is its significance in research?

Rhizobium meliloti Aquaporin Z 2 (aqpZ2) is a membrane water channel protein found in the nitrogen-fixing bacterium Rhizobium meliloti (also called Sinorhizobium meliloti). This protein belongs to the aquaporin family, which facilitates the transport of water molecules across cell membranes. Aquaporins are crucial for cellular water homeostasis and osmotic regulation in bacteria. Rhizobium meliloti is particularly significant in agricultural research as it forms symbiotic relationships with leguminous plants, enabling nitrogen fixation. The aqpZ2 protein may play important roles in bacterial adaptation to osmotic stress conditions encountered during symbiosis, making it a valuable target for both basic microbiology research and applied agricultural studies focusing on plant-microbe interactions .

How does aqpZ2 differ from other bacterial aquaporins structurally and functionally?

Rhizobium meliloti aqpZ2 consists of 232 amino acids forming a tetrameric structure with each monomer having six transmembrane domains connected by five loops, similar to other bacterial aquaporins. What distinguishes aqpZ2 is its amino acid sequence, which contains specific residues in the selectivity filter region that determine its water specificity and transport efficiency . The full amino acid sequence (MFKKLCAEFLGTCWLVLGGCGSAVLASAFPQVGIGLLGVSFAFGLTVLTMAYTVGGISGGHFNPAVSLGLAVAGRVPAASLVSYVIAQVAGAIIAAAVLYVIATGKADFQLGSFAANGYGEHSPGGYSLTAALVTEVVMTFFFLIIILGSTHRRVPAGFAPIAIGLALTLIHLVSIPVTNTSVNPARSTGQALFVGGWALSQLWLFWIAPLFGAAIAGIVWKSVGEEFRPVD) reveals distinct features compared to other aquaporins . Functionally, while most bacterial aquaporins primarily transport water, aqpZ2 might have evolved specific transport properties adapted to the symbiotic lifestyle of Rhizobium meliloti, potentially contributing to osmotic adaptation during root nodule formation and nitrogen fixation processes .

What are the key features of recombinant aqpZ2 protein structure that researchers should be aware of?

Researchers working with recombinant aqpZ2 should be aware of several key structural features that impact experimental design and interpretation:

The recombinant protein typically adopts its native conformation when properly expressed and purified, but researchers should verify structural integrity through circular dichroism or other biophysical techniques before conducting functional experiments.

What expression systems are most effective for producing recombinant Rhizobium meliloti aqpZ2?

For recombinant expression of Rhizobium meliloti aqpZ2, Escherichia coli remains the most commonly used and effective heterologous expression system. E. coli provides several advantages for aqpZ2 expression including:

  • Genetic compatibility: Since both R. meliloti and E. coli are gram-negative bacteria, the codon usage and protein folding machinery are reasonably compatible

  • High yield: E. coli systems can produce sufficient quantities of protein for structural and functional studies

  • Established protocols: Well-optimized protocols exist for membrane protein expression in E. coli

The commercially available recombinant aqpZ2 is produced using E. coli expression systems with His-tag modifications for purification purposes . For researchers establishing their own expression systems, BL21(DE3) or C41(DE3) E. coli strains are recommended as they are engineered for membrane protein expression. Expression vectors containing strong inducible promoters (T7 or tac) with temperature optimization (typically 18-25°C after induction) help minimize inclusion body formation. Addition of glycerol (5-10%) to the culture medium can also improve membrane protein folding and stability during expression .

How should researchers optimize purification protocols for recombinant aqpZ2?

Optimizing purification protocols for recombinant aqpZ2 requires careful consideration of its membrane protein nature. The following methodology is recommended:

  • Membrane isolation: After cell lysis (using sonication or French press), separate membrane fractions through ultracentrifugation (typically 100,000 × g for 1 hour)

  • Solubilization: Use mild detergents to extract the protein from membranes. n-Dodecyl β-D-maltoside (DDM) at 1-2% concentration is often effective for aquaporins while maintaining their structure and function

  • Affinity chromatography: For His-tagged aqpZ2, use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin, gradually increasing imidazole concentration (20-250 mM) in buffers containing 0.05-0.1% detergent

  • Size exclusion chromatography: Further purify the protein using gel filtration to separate tetrameric aqpZ2 from aggregates and other impurities

  • Quality assessment: Verify purity by SDS-PAGE (>90% purity is recommended for most applications)

  • Storage considerations: Store purified aqpZ2 in appropriate buffer (typically Tris/PBS-based buffer with 6% trehalose at pH 8.0) to maintain stability . Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

For reconstitution before experimental use, follow the manufacturer's recommendation to reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding glycerol (final concentration 5-50%) for long-term storage stability .

What are the critical factors affecting the stability of purified recombinant aqpZ2?

Several critical factors affect the stability of purified recombinant aqpZ2:

FactorOptimal ConditionImpact on Stability
Storage temperature-20°C to -80°CPrevents protein degradation and maintains structural integrity
Buffer compositionTris/PBS-based with 6% trehalose, pH 8.0Maintains protein folding and prevents aggregation
Detergent concentration0.05-0.1% (maintenance concentration)Prevents aggregation while avoiding destabilization
Glycerol content5-50% (typically 50% recommended)Prevents freezing damage during storage
Freeze-thaw cyclesMinimize; use single-use aliquotsRepeated cycles cause denaturation and reduced activity
Protein concentration0.1-1.0 mg/mL after reconstitutionToo high concentrations may promote aggregation

Researchers should be particularly vigilant about avoiding repeated freeze-thaw cycles, as noted in the product specifications . Working aliquots should be maintained at 4°C for up to one week. For optimal results in functional studies, always verify protein integrity after storage through methods such as circular dichroism or size exclusion chromatography before conducting experiments.

What methods are most reliable for confirming the structural integrity of recombinant aqpZ2?

Confirming the structural integrity of recombinant aqpZ2 is crucial before conducting functional experiments. Several complementary methods are recommended:

Researchers should implement at least two of these methods before proceeding with functional characterization to ensure reliable experimental outcomes.

How can researchers accurately measure the water transport activity of recombinant aqpZ2?

Measuring the water transport activity of recombinant aqpZ2 requires specialized techniques that assess water permeability across membranes. The following methodologies are recommended:

  • Proteoliposome Swelling Assay:

    • Reconstitute purified aqpZ2 into liposomes at protein-to-lipid ratios of 1:100 to 1:400

    • Create an osmotic gradient by rapidly mixing proteoliposomes with hypertonic solution

    • Monitor volume changes through light scattering at 90° angle

    • Calculate water permeability coefficient (Pf) using the initial rate of volume change

  • Stopped-Flow Spectroscopy:

    • More quantitative than swelling assays

    • Mix proteoliposomes with osmotically active solutes

    • Monitor shrinkage rate using light scattering

    • Calculate Pf values from the exponential rate constants

  • Fluorescence-Based Methods:

    • Encapsulate self-quenching fluorescent dyes in proteoliposomes

    • Monitor fluorescence changes upon osmotic challenge

    • Provides real-time measurements of water flux

  • Yeast or Oocyte Expression Systems:

    • Express aqpZ2 in aquaporin-deficient yeast or Xenopus oocytes

    • Subject cells to hypotonic challenge

    • Measure volume changes microscopically or through cell bursting assays

To validate specificity, researchers should include control measurements with known aquaporin inhibitors (e.g., mercury compounds) and compare results with empty liposomes. Temperature dependence studies (measuring activation energy) can further confirm channel-mediated water transport versus diffusion through membrane.

What phosphorylation patterns might affect aqpZ2 function and how can they be studied?

Human AQP2 is regulated by phosphorylation at four sites (Ser256, Ser261, Ser264, and Thr269), with Ser256 being crucial for membrane trafficking . Although bacterial aquaporins lack the C-terminal extension containing these specific sites, they may have alternative phosphorylation sites affecting channel function or protein-protein interactions.

To study potential phosphorylation of aqpZ2:

  • Phosphorylation Site Prediction:

    • Use bioinformatics tools (NetPhos, PhosphoSite) to predict potential phosphorylation sites

    • Focus on serine, threonine, and tyrosine residues in cytoplasmic regions

  • Phosphorylation Detection:

    • Mass spectrometry analysis of purified protein

    • Western blotting with phospho-specific antibodies

    • Phos-tag SDS-PAGE to detect mobility shifts caused by phosphorylation

  • Functional Assessment:

    • Generate phosphomimetic mutants (S→E or T→E) and phosphodeficient mutants (S→A or T→A)

    • Compare water transport activity between wild-type and mutant proteins

    • Assess protein-protein interactions using techniques like microscale thermophoresis, as demonstrated with AQP2-LIP5 interactions

  • Kinase Identification:

    • Test bacterial kinase candidates using in vitro kinase assays

    • Perform co-immunoprecipitation to identify interacting kinases

Understanding phosphorylation patterns could provide insights into how aqpZ2 function might be regulated during environmental stress or symbiotic interactions in Rhizobium meliloti.

How can researchers effectively use recombinant aqpZ2 in studies of osmotic stress responses in Rhizobium meliloti?

Recombinant aqpZ2 can be an invaluable tool for investigating osmotic stress responses in Rhizobium meliloti, particularly in the context of plant-microbe symbiosis. Researchers can implement the following experimental approaches:

  • Complementation Studies:

    • Generate aqpZ2 knockout strains of R. meliloti

    • Complement with wild-type or mutant recombinant aqpZ2

    • Assess growth under various osmotic conditions (drought, salinity)

    • Measure nodulation efficiency and nitrogen fixation with host plants

  • Expression Analysis:

    • Monitor native aqpZ2 expression levels under different osmotic stresses using qRT-PCR

    • Correlate expression with bacterial survival and symbiotic efficiency

    • Use GFP-fusion proteins to track subcellular localization during stress

  • Functional Characterization:

    • Compare water permeability of membrane vesicles isolated from wild-type and aqpZ2-deficient strains

    • Assess changes in cellular water content and volume under osmotic challenge

    • Measure intracellular solute concentrations to determine osmoregulatory responses

  • Protein-Protein Interaction Studies:

    • Identify potential interaction partners using pull-down assays with recombinant His-tagged aqpZ2

    • Verify interactions using techniques like biolayer interferometry or microscale thermophoresis

    • Determine if interactions are modulated by osmotic conditions

This multifaceted approach can help establish the precise role of aqpZ2 in Rhizobium meliloti's adaptation to osmotic stress, with implications for improving agricultural practices in drought-prone regions.

What are the best approaches for studying aqpZ2 expression regulation in symbiotic versus free-living conditions?

Studying aqpZ2 expression regulation under different growth conditions requires a combination of molecular and physiological approaches:

  • Transcriptional Analysis:

    • Perform RNA-seq comparing free-living bacteria versus bacteroids within nodules

    • Use qRT-PCR to quantify aqpZ2 mRNA levels under various conditions

    • Map the aqpZ2 promoter region and identify potential regulatory elements

  • Reporter Systems:

    • Construct aqpZ2 promoter-reporter fusions (GFP, LacZ) to monitor expression

    • Use time-lapse microscopy to track expression changes during nodule development

    • Analyze expression in different nodule zones using confocal microscopy

  • Chromatin Immunoprecipitation (ChIP):

    • Identify transcription factors binding to the aqpZ2 promoter

    • Determine if symbiosis-specific factors regulate expression

    • Map DNA-binding sites precisely using ChIP-seq

  • Environmental Variables Testing:

    • Systematically vary oxygen concentration, pH, osmolarity, and nutrient availability

    • Create conditions mimicking the rhizosphere and nodule microenvironment

    • Assess aqpZ2 expression in response to plant-derived signals (flavonoids, exudates)

  • Genetic Approaches:

    • Screen for regulatory mutants with altered aqpZ2 expression

    • Test expression in strains with mutations in known symbiotic regulators

    • Perform transposon mutagenesis followed by screening for altered aqpZ2 expression

These approaches can reveal how aqpZ2 expression is coordinated with other symbiosis-related genes and how environmental cues trigger its regulation, providing insights into the adaptation of Rhizobium meliloti to its dual lifestyle.

How can structural comparisons between aqpZ2 and other aquaporins inform directed mutagenesis experiments?

Structural comparisons between aqpZ2 and other well-characterized aquaporins provide a foundation for rational mutagenesis experiments:

  • Key Structural Regions for Mutagenesis:

    RegionFunctional SignificanceMutagenesis Strategy
    NPA motifsCentral to water selectivityConservative substitutions to alter pore size
    Aromatic/Arginine constrictionDetermines solute specificityModify charge or size to alter selectivity
    Loop regionsMay interact with other proteinsAlanine scanning to identify interaction surfaces
    Transmembrane interfacesImportant for tetramer stabilityTarget residues at monomer interfaces
  • Comparative Analysis Approach:

    • Align aqpZ2 sequence with human AQPs and other bacterial aquaporins

    • Identify conserved versus divergent residues

    • Focus on positions that differ between aquaporins with known functional differences

    • Create homology models based on crystal structures of related aquaporins

  • Functional Prediction:

    • Use molecular dynamics simulations to predict effects of mutations

    • Calculate water permeation rates through wild-type and mutant channels

    • Model interactions with potential physiological solutes

  • Experimental Validation:

    • Express mutant proteins using the same E. coli system used for wild-type

    • Verify proper folding and tetrameric assembly

    • Compare water transport properties using proteoliposome assays

    • Test permeability to other molecules (glycerol, ammonia, urea)

This structure-guided approach can reveal the molecular basis for aqpZ2's specific properties and potentially engineer variants with enhanced or altered functions for biotechnological applications.

How does the presence of multiple replication systems in Rhizobium meliloti impact recombinant aqpZ2 expression studies?

Rhizobium meliloti possesses a complex genome architecture with multiple replicons, including a chromosome and several plasmids with different replication systems, which significantly impacts recombinant expression studies:

  • Genomic Context Considerations:

    • The aqpZ2 gene may be located on accessory plasmids rather than the main chromosome

    • Research indicates that S. meliloti contains both repABC and repC replication modules that exhibit different stability behaviors

    • The repABC system shows greater stability compared to the repC system, suggesting differential regulation of plasmid maintenance

  • Expression Vector Design:

    • When designing expression vectors for complementation studies in R. meliloti, researchers should consider:

      • Selecting replicons compatible with native plasmids

      • Using the more stable repABC replication system for consistent expression

      • Accounting for potential incompatibility between introduced and native replicons

  • Copy Number Effects:

    • Different replication systems result in varying plasmid copy numbers

    • High copy number vectors may lead to overexpression artifacts

    • Researchers should match expression levels to physiological conditions

  • Experimental Design Strategies:

    • Consider chromosomal integration rather than plasmid-based expression for long-term studies

    • Implement inducible promoters to control expression levels

    • Monitor plasmid stability throughout experiments, especially under stress conditions

    • Account for potential plasmid loss in the absence of selection pressure

Understanding these complex genomic dynamics is crucial for designing reliable expression systems that accurately reflect the native regulation and function of aqpZ2 in Rhizobium meliloti.

What approaches can resolve contradictory data on aqpZ2 function in different experimental systems?

Researchers frequently encounter contradictory data when studying aqpZ2 function across different experimental systems. A systematic approach to resolving these contradictions includes:

  • System-Specific Variables Analysis:

    • Compare protein expression levels across systems using quantitative Western blots

    • Assess membrane composition differences that might affect protein folding or function

    • Evaluate post-translational modifications present in each system

    • Consider differences in cellular physiology (pH, ion concentrations) between systems

  • Methodological Standardization:

    • Develop standardized protocols for protein expression and purification

    • Use identical buffer compositions and detergents across studies

    • Implement consistent activity assay conditions (temperature, pH, osmolarity)

    • Include internal controls and reference standards in all experiments

  • Integrative Analysis Techniques:

    • Perform meta-analysis of existing data to identify patterns in contradictions

    • Use statistical approaches to weight results based on methodological rigor

    • Develop mathematical models to reconcile apparently contradictory findings

  • Collaborative Cross-Validation:

    • Establish multi-laboratory validation studies using identical materials

    • Implement blind testing protocols to minimize bias

    • Share raw data and detailed protocols to identify subtle methodological differences

  • Addressing Specific Contradictions:

    • For kinetic discrepancies: Perform Arrhenius plot analysis across temperature ranges

    • For substrate specificity conflicts: Test with purified substrates across concentration ranges

    • For regulatory discrepancies: Systematically test all potential modulators independently and in combination

This comprehensive approach not only resolves contradictions but often leads to deeper insights into context-dependent aspects of aqpZ2 function that may have biological significance.

How can researchers effectively integrate structural biology, functional analysis, and in vivo studies of aqpZ2?

Effective integration of multiple research approaches provides the most comprehensive understanding of aqpZ2:

  • Sequential Multi-Method Pipeline:

    • Begin with structural determination (X-ray crystallography, cryo-EM, or homology modeling)

    • Proceed to in vitro functional characterization using purified protein

    • Validate findings in cellular systems (heterologous expression)

    • Confirm physiological relevance in Rhizobium meliloti

  • Structure-Function Correlations:

    • Use site-directed mutagenesis guided by structural insights

    • Correlate structural features with functional parameters

    • Develop structure-based predictive models for function

    • Identify structural changes during transport cycle using techniques like hydrogen-deuterium exchange

  • Multi-Scale Analysis Framework:

    ScaleMethodsIntegration Approach
    AtomicX-ray crystallography, NMR, MD simulationsIdentify key residues for mutagenesis
    ProteinFunctional assays, biophysical characterizationTest predictions from structural studies
    CellularMicroscopy, transport assays in cellsValidate function in cellular environment
    OrganismalGrowth/survival assays, symbiosis studiesConnect molecular function to biological roles
  • Integrated Data Analysis:

    • Develop computational models incorporating data from all levels

    • Use machine learning to identify patterns across datasets

    • Create accessible databases integrating all aquaporin structural and functional data

    • Apply systems biology approaches to place aqpZ2 in broader cellular networks

  • Translational Research Connections:

    • Apply insights to agricultural applications

    • Explore biotechnological applications (water filtration, sensor development)

    • Investigate aqpZ2 as a potential target for modulating plant-microbe interactions

This integrated approach overcomes the limitations of individual methods and provides a comprehensive understanding of how aqpZ2 structure determines its function and how that function contributes to Rhizobium meliloti's ecological role and symbiotic relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.