Recombinant Rhizobium meliloti ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via bacterial expression systems and purified using nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography due to its His-tag. Key parameters include:

ParameterDetail
HostE. coli
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stability
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
FormLyophilized powder

The protein is lyophilized to prevent degradation and is reconstituted in sterile water for experimental use .

ELISA Assays

The recombinant atpB protein is used as an antigen in ELISA kits to detect specific antibodies or quantify protein levels in samples. Key specifications include:

AttributeDetail
Product TypeRecombinant protein
Quantity50 µg (customizable)
ELISA BufferTris-based buffer, 50% glycerol
ApplicationsImmunoassays, protein quantification, antibody detection

This kit enables precise measurement of atpB in biological samples, aiding studies on ATP synthase regulation or bacterial pathogenesis .

Genomic and Evolutionary Context

The atpB gene resides on the main chromosome of R. meliloti, classified as a housekeeping gene essential for cellular energy production. Genome-wide analyses reveal minimal gene duplication, emphasizing its conserved role across α-proteobacteria .

Table 2: Amino Acid Sequence of Recombinant atpB

Sequence
MSNDPTHQFLVNKIVPLEIGGIDFSFTNASLFMVATVGAAAGFLYLTTSQRGLIPTRMQS VSEMSYEFIASmLREGAGSHGMKFFPMVFSLFMFILTANLLGMVPYFFTVTSQIIVTFAL AVFVIGTVLLYGFYKHGFGFLKLFVPQGVPGALLPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLSAFGALGIGGAILPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAVHPGGH

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; R00835; SMc00871; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
atpB
Target Protein Sequence
MSNDPTHQFLVNKIVPLEIGGIDFSFTNASLFMVATVGAAAGFLYLTTSQRGLIPTRMQS VSEMSYEFIASMLREGAGSHGMKFFPMVFSLFMFILTANLLGMVPYFFTVTSQIIVTFAL AVFVIGTVLLYGFYKHGFGFLKLFVPQGVPGALLPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLSAFGALGIGGAILPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAVHPGGH
Uniprot No.

Target Background

Function
A key component of the proton channel, it directly facilitates proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Rhizobium meliloti metabolism?

ATP synthase subunit a (atpB) is a critical component of the F₀ domain of the F₀F₁-ATP synthase complex in R. meliloti. This membrane-embedded subunit forms part of the proton channel that couples the proton gradient across the membrane to ATP synthesis. In R. meliloti, ATP synthesis is particularly important during energy-intensive processes like nitrogen fixation and carbon metabolism. The bacterium possesses several central carbon metabolic pathways including a cyclic Entner-Doudoroff pathway, a complete pentose phosphate pathway, and tricarboxylic acid cycle that all depend on ATP-related energetics . The ATP synthase complex serves as the primary mechanism for oxidative phosphorylation, utilizing the proton motive force generated by electron transport chains to synthesize ATP required for cellular functions.

How is recombinant R. meliloti atpB typically expressed in laboratory settings?

Recombinant R. meliloti ATP synthase subunit a (atpB) is typically expressed in E. coli expression systems using vectors that incorporate affinity tags for purification purposes. Current protocols commonly utilize N-terminal His-tagged constructs of the full-length protein (amino acids 1-250) . The protein coding sequence is usually optimized for E. coli codon usage to enhance expression efficiency. Expression is typically performed under the control of inducible promoters like T7 or tac, with optimal induction conditions generally requiring temperatures between 18-30°C to minimize inclusion body formation. Membrane proteins like atpB often require specialized extraction approaches using detergents for solubilization. Purification commonly involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain pure protein for downstream applications.

What are the challenges associated with expressing functional recombinant R. meliloti atpB?

Expressing functional recombinant R. meliloti atpB presents several significant challenges:

  • Membrane protein expression: As an integral membrane protein, atpB requires proper insertion into a lipid bilayer for folding and activity. Expression in E. coli often results in aggregation or inclusion body formation .

  • Protein toxicity: Overexpression of membrane-spanning portions of ATP synthase components can disrupt host cell membrane integrity, leading to growth inhibition or cell death.

  • Proper folding and assembly: The atpB subunit normally functions as part of a multi-subunit complex, and isolated expression may yield incorrectly folded protein lacking functional activity.

  • Post-translational modifications: Any R. meliloti-specific modifications required for activity may be absent in heterologous expression systems.

  • Protein stability: Once extracted from membranes, maintaining stability in detergent micelles represents a significant challenge, often requiring extensive optimization of buffer conditions.

These challenges can be addressed through strategies such as using specialized E. coli strains (e.g., C41/C43 designed for membrane protein expression), employing fusion partners to enhance solubility, and developing cell-free expression systems with supplied lipids or nanodiscs.

What experimental approaches can be used to assess ATP binding and hydrolysis activity of recombinant R. meliloti atpB?

Assessment of ATP binding and hydrolysis activity of recombinant R. meliloti atpB requires sophisticated biochemical approaches:

ATP Binding Assays:

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of ATP binding including binding affinity (Kd), stoichiometry, and enthalpy changes. This technique allows detection of binding even at nanomolar concentrations of ATP .

  • Surface Plasmon Resonance (SPR): Evaluates real-time binding kinetics of ATP to immobilized atpB. Analysis can reveal association and dissociation rates.

  • Fluorescence-based assays: Utilizing fluorescent ATP analogs (e.g., TNP-ATP) that exhibit enhanced fluorescence upon protein binding.

ATP Hydrolysis Assays:

  • Malachite Green Assay: Quantifies released inorganic phosphate from ATP hydrolysis.

  • Coupled Enzyme Assays: Links ATPase activity to NADH oxidation through pyruvate kinase and lactate dehydrogenase, allowing continuous spectrophotometric monitoring.

  • Radiolabeled ATP Assays: Uses [γ-³²P]ATP to directly measure phosphate release.

These assays must be optimized considering that ATP binding proteins in related organisms show specific buffer and pH requirements. For instance, studies on related ATP-binding proteins in R. meliloti demonstrated that alanine substitutions in phosphate-binding loops disrupted ATP hydrolysis while sometimes maintaining ATP binding capacity, suggesting distinct structural requirements for these functions .

How can site-directed mutagenesis be used to study structure-function relationships in R. meliloti atpB?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in R. meliloti atpB. This methodology allows for systematic alteration of specific amino acid residues to determine their contributions to protein structure, stability, and function.

Experimental Design Approach:

  • Target Selection:

    • Focus on conserved residues in the phosphate-binding loop/Walker A motif (typically GXXXXGK(T/S)), which is critical for ATP binding and hydrolysis in related proteins

    • Identify charged residues in transmembrane segments that likely participate in proton translocation

    • Target residues at subunit interfaces that mediate protein-protein interactions within the ATP synthase complex

  • Mutation Strategy:

    • Conservative substitutions (e.g., Lys→Arg) to maintain charge but alter side chain structure

    • Alanine scanning mutagenesis to remove side chain functionality while minimizing structural perturbation

    • Introduction of cysteine residues for subsequent chemical modification or cross-linking studies

  • Functional Analysis:

    • Compare ATP binding affinity between wild-type and mutant proteins using isothermal titration calorimetry

    • Assess ATP hydrolysis rates using coupled enzyme assays or phosphate release measurements

    • Evaluate proton translocation using reconstituted proteoliposomes and pH-sensitive fluorescent dyes

    • Examine stability and folding through thermal denaturation studies

Studies on related ATP-binding proteins in R. meliloti have demonstrated that alanine substitutions at positions 3, 4, 6, 7, and 8 of the phosphate-binding loop motif can disrupt transcriptional activation and ATP hydrolysis, providing a template for similar investigations with atpB . Notably, some mutations may affect ATP binding without impacting hydrolysis or vice versa, revealing distinct functional domains within the protein.

What reconstitution methods are most effective for studying R. meliloti atpB function in vitro?

Effective reconstitution of R. meliloti atpB for functional studies requires methodologies that maintain protein structure and activity in a membrane-like environment. The following approaches have proven most effective:

Proteoliposome Reconstitution:

  • Detergent-mediated reconstitution: Purified atpB is mixed with phospholipids in detergent solution, followed by controlled detergent removal via dialysis, Bio-Beads, or cyclodextrin.

  • Lipid composition optimization: A mixture of E. coli polar lipids supplemented with phosphatidylcholine (70:30 ratio) often provides a suitable membrane environment.

  • Protein:lipid ratios: Typically optimized between 1:50 to 1:200 (w/w) to ensure proper protein incorporation without aggregation.

Nanodiscs Assembly:

  • Membrane scaffold proteins (MSPs) are used to create disc-shaped lipid bilayers of defined size.

  • atpB is incorporated during nanodisc assembly, yielding a soluble protein-lipid complex amenable to various biophysical techniques.

  • This approach allows precise control of oligomeric state and lipid environment.

Functional Assessment:

  • Proton pumping can be measured using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine).

  • ATP synthesis can be monitored by establishing a proton gradient and measuring ATP production using luciferase-based assays.

  • Protein orientation in reconstituted systems can be determined using site-specific antibodies or proteolytic digestion.

These reconstitution approaches must consider the functional coupling between atpB and other ATP synthase subunits, as isolated atpB may exhibit altered properties compared to the intact complex. Research on related bacterial ATP synthases suggests that reconstitution efficiency is highly dependent on detergent choice during solubilization, with milder detergents like DDM typically yielding better functional recovery than stronger detergents like SDS or Triton X-100.

How does atpB function relate to carbon metabolism in R. meliloti?

The function of ATP synthase subunit a (atpB) is integrally connected to carbon metabolism in R. meliloti through bioenergetic coupling. This relationship encompasses several key aspects:

Respiratory Chain Coupling:

  • The oxidation of carbon sources through the TCA cycle generates reducing equivalents (NADH, FADH₂)

  • These reducing equivalents feed electrons into the respiratory chain

  • Electron transport creates the proton gradient that drives ATP synthesis via ATP synthase containing the atpB subunit

Carbon Source Utilization:
Studies show that R. meliloti can utilize diverse carbon sources including:

  • C₄-dicarboxylic acids (succinate, malate)

  • Hexoses (glucose, galactose)

  • Pentoses (xylose, ribose)

The ability to metabolize these various carbon sources depends on generating sufficient ATP through oxidative phosphorylation, which requires functional ATP synthase complexes .

Metabolic Adaptations:
During symbiosis with legume hosts, R. meliloti must adapt its metabolism to microaerobic conditions. Under these circumstances, the ATP synthase complex likely undergoes regulatory adjustments to maintain efficient ATP production despite altered electron transport chain activity. The atpB subunit may play a critical role in these adaptations through its involvement in proton translocation efficiency.

Understanding atpB function provides insights into how R. meliloti balances its energy requirements during both free-living growth and symbiotic nitrogen fixation, particularly in relation to the organism's unique carbon metabolic pathways .

What is the relationship between atpB function and nitrogen fixation in R. meliloti?

The relationship between ATP synthase subunit a (atpB) function and nitrogen fixation in R. meliloti represents a critical bioenergetic connection in this symbiotically important bacterium:

Energetic Demands of Nitrogen Fixation:
Biological nitrogen fixation is an extremely energy-intensive process, requiring approximately 16 ATP molecules for each N₂ molecule reduced to ammonia. The ATP synthase complex, including the atpB subunit, plays a fundamental role in generating this essential ATP pool. The reaction catalyzed by nitrogenase can be represented as:

N₂ + 8H⁺ + 8e⁻ + 16ATP → 2NH₃ + H₂ + 16ADP + 16Pi

Microaerobic Adaptation:
Inside root nodules, R. meliloti exists in a microaerobic environment necessary to protect the oxygen-sensitive nitrogenase enzyme. This limited oxygen availability creates unique challenges for energy generation through oxidative phosphorylation. Evidence suggests that the ATP synthase complex, including atpB, undergoes regulatory adjustments to maintain ATP production efficiency under these conditions.

Bacteroid Differentiation:
During the transition from free-living cells to symbiotic bacteroids, significant metabolic remodeling occurs. Proteomic studies have shown differential expression of various metabolic enzymes, including components of energy-generating pathways . The proper functioning of ATP synthase becomes crucial during this differentiation process.

Regulatory Integration:
The ATP:ADP ratio serves as an important metabolic signal that influences various cellular processes. In R. meliloti, this ratio likely affects the expression and activity of nitrogen fixation genes through regulatory systems that monitor cellular energy status. The atpB subunit, as part of the ATP-generating machinery, indirectly influences these regulatory networks.

Research Implications:
Studies of atpB mutants in R. meliloti could provide valuable insights into the bioenergetic requirements of symbiotic nitrogen fixation. Similarly, investigations of how different carbon sources affect ATP generation and nitrogen fixation efficiency may reveal important metabolic interactions that determine symbiotic effectiveness.

How can recombinant atpB be used to study antimicrobial targets in Rhizobium?

Recombinant R. meliloti ATP synthase subunit a (atpB) offers several valuable approaches for investigating antimicrobial targets specific to Rhizobium species:

ATP Synthase as an Antimicrobial Target:

  • ATP synthase represents an increasingly recognized antimicrobial target due to its essential role in bacterial bioenergetics

  • The unique structural features of bacterial ATP synthases versus mammalian homologs provide opportunities for selective targeting

  • The atpB subunit, with its crucial role in proton translocation, presents specific structural elements that could be exploited for Rhizobium-selective inhibition

Screening Methodologies Using Recombinant atpB:

  • In vitro binding assays:

    • Thermal shift assays (TSA) to identify compounds that alter protein stability

    • Surface plasmon resonance (SPR) to measure direct binding of candidate molecules

    • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

  • Functional inhibition assays:

    • ATP hydrolysis inhibition in reconstituted systems

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Competition assays with known inhibitors like dicyclohexylcarbodiimide (DCCD)

  • Structure-based approaches:

    • Using purified recombinant atpB for structural studies (X-ray crystallography, cryo-EM)

    • In silico docking screens against atpB structural models

    • Fragment-based drug discovery targeting specific binding pockets

Advantages of this Approach:

  • Recombinant atpB allows high-throughput screening without the need for whole-cell assays

  • Enables direct assessment of compound binding and inhibition mechanisms

  • Facilitates structure-activity relationship (SAR) studies for targeted optimization

  • Provides a system for identifying Rhizobium-specific inhibitors with reduced activity against beneficial microbes

This research direction is particularly relevant for agricultural applications where selective control of Rhizobium populations might be desirable without disrupting beneficial soil microbiomes. Studies on phosphate-binding loops in related ATP-binding proteins of R. meliloti provide insights into critical functional domains that could be targeted .

How can protein aggregation be prevented when expressing recombinant R. meliloti atpB?

Preventing protein aggregation during recombinant expression of R. meliloti atpB requires a multi-faceted approach addressing the challenges specific to this membrane protein:

Expression System Optimization:

ParameterStandard ApproachOptimized Approach for atpB
Expression hostBL21(DE3)C41(DE3) or C43(DE3) "Walker strains" specifically evolved for membrane protein expression
Induction temperature37°C16-20°C to slow protein synthesis and folding
Inducer concentration1.0 mM IPTG0.1-0.5 mM IPTG for gentler induction
Growth mediaLBTerrific Broth supplemented with glucose to suppress basal expression
Induction timingMid-log phase (OD₆₀₀ ~0.6)Late-log phase (OD₆₀₀ ~1.0-1.2)

Protein Engineering Strategies:

  • Fusion partners: Adding solubility-enhancing tags such as MBP, SUMO, or Mistic (a B. subtilis membrane protein facilitator)

  • Construct optimization: Removing flexible terminal regions prone to aggregation

  • Introduction of stabilizing mutations identified through homology modeling

Co-expression Approaches:

  • Chaperone co-expression (GroEL/GroES, DnaK/DnaJ/GrpE systems)

  • Co-expression with other ATP synthase subunits that normally interact with atpB

  • Expression with membrane-insertion facilitators like YidC

Solubilization and Purification:

  • Careful selection of detergents for membrane extraction (DDM, LMNG, or amphipols)

  • Addition of lipids during purification to stabilize native conformation

  • Inclusion of glycerol (10-20%) in all buffers as a stabilizing agent

  • Use of arginine and glutamate (50-100 mM each) to suppress aggregation during purification

These approaches should be systematically tested, as the optimal conditions for preventing aggregation may vary depending on the specific construct design and intended downstream applications . Experience with other membrane proteins from R. meliloti suggests that a combination of low-temperature expression in specialized hosts with appropriate detergent selection offers the highest probability of success.

What are the best methods for assessing the structural integrity of purified recombinant R. meliloti atpB?

Assessing the structural integrity of purified recombinant R. meliloti atpB requires specialized techniques appropriate for membrane proteins. These methods evaluate protein folding, stability, and native conformation:

Spectroscopic Methods:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm): Quantifies secondary structure content (α-helices, β-sheets)

    • Near-UV CD (250-350 nm): Evaluates tertiary structure through aromatic residue environments

    • Thermal denaturation CD: Monitors unfolding transitions to determine stability

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence: Changes in emission maxima indicate alterations in protein folding

    • ANS binding: This hydrophobic dye binds to exposed hydrophobic regions, indicating partial unfolding

    • FRET-based approaches using strategic labeling to measure distances between protein domains

Hydrodynamic and Structural Analysis:

Functional Integrity Assessments:

  • Ligand Binding Assays:

    • Isothermal titration calorimetry (ITC) to measure ATP binding parameters

    • Fluorescent ATP analogs to monitor binding capacity

  • Limited Proteolysis:

    • Well-folded proteins show resistance to proteolytic digestion at low protease concentrations

    • Digest patterns can identify flexible/exposed regions versus protected domains

  • Thermal Stability Assays:

    • Differential scanning fluorimetry using environmentally sensitive dyes

    • Nanoscale differential scanning calorimetry (nano-DSC) to determine unfolding transitions

These methods should be used in combination to provide a comprehensive assessment of atpB structural integrity. Research on other membrane proteins suggests that CD spectroscopy combined with SEC-MALS analysis provides the most accessible initial evaluation of fold integrity, while functional assays provide the ultimate validation of native-like structure .

How can researchers troubleshoot issues with atpB integration into functional ATP synthase complexes?

Troubleshooting the integration of recombinant R. meliloti atpB into functional ATP synthase complexes requires systematic analysis of multiple potential failure points in the assembly process:

Assembly Failure Diagnosis:

ProblemDiagnostic ApproachPotential Solutions
Improper membrane insertionAlkaline extraction assay to determine membrane integration efficiencyOptimize signal sequence or use specialized membrane insertion systems (BAM complex co-expression)
Incorrect topologyAccessibility mapping using introduced cysteine residues and membrane-impermeable labeling reagentsEngineer topological markers or expression tags at specific locations
Subunit interaction failuresChemical crosslinking to detect protein-protein interactions between atpB and other ATP synthase componentsCo-expression with interacting partner subunits
Proton channel dysfunctionProton leakage assays in reconstituted proteoliposomes using pH-sensitive fluorescent dyesSite-directed mutagenesis to restore critical residues in proton path
ATP hydrolysis without synthesisMeasurement of ATP hydrolysis:synthesis ratio in reconstituted systemsOptimization of reconstitution conditions and membrane potential generation

Methodological Troubleshooting Approaches:

  • In vivo Complementation Testing:

    • Introduction of recombinant atpB into ATP synthase-deficient strains

    • Growth assessment under conditions requiring oxidative phosphorylation

    • Measurement of membrane potential in complemented strains

  • Stepwise Assembly Analysis:

    • Sequential addition of purified subunits to monitor complex formation

    • Use of partially assembled subcomplexes as scaffolds for atpB integration

    • Native PAGE analysis to track assembly intermediates

  • Protein Modification Strategies:

    • Introduction of affinity tags at positions that don't interfere with assembly

    • Site-specific crosslinking to stabilize transient interactions

    • Fluorescent labeling for FRET-based assembly monitoring

  • Environmental Optimization:

    • Screening different lipid compositions for reconstitution

    • Testing various detergents for their effects on complex stability

    • Evaluation of buffer components (ionic strength, pH, specific ions)

  • Structure-Guided Troubleshooting:

    • Homology modeling based on related bacterial ATP synthases

    • Identification of critical interface residues for targeted modification

    • Design of compensatory mutations in interacting subunits

These approaches address the complex challenge of assembling functional multi-subunit membrane protein complexes. Research on phosphate-binding loops in ATP-binding proteins of R. meliloti provides insights into critical functional domains that might influence assembly . Experience with reconstitution of other membrane protein complexes suggests that lipid composition and protein:lipid ratios are frequently the most critical parameters for successful integration.

How might structural studies of R. meliloti atpB inform biotechnological applications?

Structural studies of R. meliloti atpB hold significant potential to inform diverse biotechnological applications by providing atomic-level insights into this essential membrane protein's function:

ATP Synthase Engineering:
Detailed structural information about R. meliloti atpB could enable rational design of modified ATP synthases with altered properties:

  • Enhanced thermostability for industrial applications

  • Modified coupling efficiency between proton translocation and ATP synthesis

  • Altered regulatory properties to increase ATP production under specific conditions

  • Engineering variants with resistance to inhibitors or environmental stressors

Biomimetic Energy Conversion:
The proton translocation mechanism in atpB represents a remarkably efficient biological energy conversion system that could inspire:

  • Development of artificial proton-conducting membranes

  • Design of synthetic molecular motors based on rotary mechanisms

  • Creation of biomimetic energy-harvesting devices that convert proton gradients to usable energy

  • Nanoscale power generators for biomedical applications

Drug Discovery Platforms:
The unique structural features of bacterial ATP synthases compared to their eukaryotic counterparts make them attractive antibiotic targets:

  • Structure-based virtual screening against R. meliloti atpB models

  • Fragment-based approaches targeting specific binding pockets

  • Rational design of selective inhibitors targeting the proton channel

  • Development of allosteric modulators that alter ATP synthase efficiency

Biosensor Development:
atpB's sensitivity to membrane potential and proton gradients could be exploited for:

  • Development of whole-cell biosensors for environmental monitoring

  • Creation of protein-based sensors for detecting membrane-active compounds

  • Engineering reporter systems for metabolic engineering applications

  • Design of diagnostic tools for assessing cellular bioenergetics

These applications would build on the understanding that ATP synthase is not merely an energy-producing enzyme but a sophisticated molecular machine whose structure-function relationships can inform diverse technologies. Research on phosphate-binding proteins in R. meliloti provides a foundation for understanding critical functional domains , while studies on carbon metabolism illuminate the broader metabolic context in which ATP synthase operates .

What are the current gaps in understanding R. meliloti atpB structure-function relationships?

Despite advances in understanding bacterial ATP synthases, several critical gaps remain in our knowledge of R. meliloti atpB structure-function relationships:

Structural Gaps:

  • High-Resolution Structure:
    No atomic-resolution structure exists specifically for R. meliloti atpB, limiting our understanding of species-specific features. While homology models based on related bacterial ATP synthases provide insights, they cannot capture unique structural elements.

  • Conformational Dynamics:
    The conformational changes in atpB during proton translocation remain poorly characterized. Time-resolved structural studies are needed to understand the dynamic aspects of proton channel operation.

  • Lipid-Protein Interactions:
    The specific lipid requirements for atpB function and the location of lipid-binding sites are largely unknown, despite the critical role of the membrane environment in ATP synthase function.

Functional Gaps:

  • Proton Pathway Specifics:
    The exact path of protons through the atpB subunit, including key residues involved in proton coordination and transfer, requires further elucidation through mutagenesis and functional studies.

  • Regulatory Mechanisms:
    How atpB function is regulated in response to changing metabolic conditions, particularly during the transition to symbiotic nitrogen fixation, remains poorly understood.

  • Assembly Process:
    The biogenesis pathway for incorporation of atpB into the complete ATP synthase complex, including any R. meliloti-specific chaperones or assembly factors, is not well characterized.

Methodological Challenges:

  • Functional Reconstitution:
    Development of reliable methods for reconstituting purified atpB into functional complexes suitable for biophysical and biochemical studies.

  • In vivo Assessment:
    Techniques for evaluating atpB function within living R. meliloti cells under different physiological conditions, particularly during symbiosis.

  • Interface with Other Subunits:
    Characterization of the molecular interactions between atpB and other ATP synthase subunits, including identification of critical interface residues.

How might studies of atpB contribute to understanding symbiotic nitrogen fixation mechanisms?

Studies of R. meliloti atpB can provide critical insights into symbiotic nitrogen fixation mechanisms through several interconnected research avenues:

Bioenergetic Support for Nitrogenase Activity:
Nitrogen fixation is extremely energy-intensive, requiring approximately 16 ATP molecules per N₂ reduced. Understanding how ATP synthase, with atpB as a key component, functions under the microaerobic conditions of root nodules is fundamental to comprehending nitrogen fixation energetics.

Research approaches could include:

  • Measurement of ATP synthase activity in bacteroids versus free-living cells

  • Analysis of expression and post-translational modifications of atpB during nodule development

  • Investigation of how ATP synthase efficiency affects nitrogenase activity through metabolic flux analysis

Adaptation to Microaerobic Environments:
The low oxygen concentration in nodules creates unique challenges for energy generation through oxidative phosphorylation. The ATP synthase complex likely undergoes adaptations to function optimally under these conditions.

Key questions include:

  • How does atpB function change under varying oxygen concentrations?

  • Are there structural modifications or regulatory mechanisms that enhance ATP synthesis efficiency under microaerobic conditions?

  • What is the relationship between atpB activity and the expression/function of terminal oxidases used in low-oxygen respiration?

Research in this area could explore:

  • How different carbon sources affect ATP synthase activity and nitrogen fixation rates

  • The relationship between the TCA cycle, electron transport chain, and ATP synthase function in bacteroids

  • Metabolic modeling of energy flows during symbiotic nitrogen fixation, with ATP synthase as a central component

Signaling and Regulation:
ATP levels serve as important signals in bacterial physiology. Studies of atpB could reveal how ATP production is regulated during symbiosis and how these regulatory mechanisms coordinate with other symbiotic processes.

Approaches might include:

  • Investigation of how plant signals affect ATP synthase expression and activity

  • Analysis of how ATP:ADP ratios influence gene expression during nodule development

  • Identification of regulatory proteins that interact directly with the ATP synthase complex

These studies would contribute significantly to our understanding of the bioenergetic basis of symbiotic nitrogen fixation, potentially leading to strategies for enhancing this agriculturally important process. Research on carbon metabolism in R. meliloti provides essential context for understanding the metabolic framework in which ATP synthase operates .

What are the optimal conditions for purifying functional recombinant R. meliloti atpB?

Purification of functional recombinant R. meliloti atpB requires careful optimization at each step to maintain the protein's native conformation and activity. The following protocol represents current best practices based on experience with similar membrane proteins:

Optimal Purification Protocol:

  • Cell Lysis and Membrane Preparation:

    • Buffer composition: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM MgCl₂, 10% glycerol

    • Protease inhibitors: Complete EDTA-free protease inhibitor cocktail

    • Lysis method: Cell disruption using pressure homogenization (15,000-20,000 psi)

    • Membrane isolation: Differential centrifugation (low-speed clarification followed by ultracentrifugation at 150,000 × g for 1 hour)

  • Membrane Protein Solubilization:

    • Optimal detergents: n-Dodecyl-β-D-maltoside (DDM, 1%) or Lauryl Maltose Neopentyl Glycol (LMNG, 0.5%)

    • Solubilization buffer: 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 5 mM MgCl₂, 10% glycerol, 5 mM imidazole

    • Solubilization conditions: 4°C for 2 hours with gentle rotation

    • Removal of insoluble material: Ultracentrifugation at 100,000 × g for 30 minutes

  • Affinity Chromatography:

    • Resin: Ni-NTA for His-tagged constructs

    • Washing buffer: 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 5 mM MgCl₂, 10% glycerol, 0.05% DDM, 20 mM imidazole

    • Elution buffer: 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 5 mM MgCl₂, 10% glycerol, 0.05% DDM, 250 mM imidazole

    • Flow rate: 0.5 ml/min to minimize pressure-induced denaturation

  • Size Exclusion Chromatography:

    • Column: Superdex 200 Increase 10/300 GL

    • Buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM MgCl₂, 5% glycerol, 0.03% DDM

    • Addition of lipids: 0.1 mg/ml E. coli polar lipid extract to stabilize protein

  • Quality Control Assessments:

    • Purity: SDS-PAGE and Western blotting

    • Homogeneity: Dynamic light scattering

    • Structural integrity: Circular dichroism spectroscopy

    • Functional activity: ATP binding assay using fluorescent ATP analogs

Critical Parameters for Success:

ParameterRecommended RangeEffect on Purification
pH7.2-7.8Affects protein stability and solubility
Ionic strength150-300 mM NaClInfluences protein-detergent interactions
Detergent concentration2-3× CMC in final buffersBelow CMC causes protein aggregation; excess detergent interferes with assays
Temperature4°C throughoutHigher temperatures accelerate denaturation
Glycerol5-10%Prevents aggregation but excess can interfere with some assays
Divalent cations5 mM MgCl₂Stabilizes ATP binding domains; chelation causes destabilization

These conditions should be fine-tuned for each specific atpB construct, with particular attention to detergent selection, which often represents the most critical variable for membrane protein purification .

What expression systems are most appropriate for different research applications of recombinant R. meliloti atpB?

Different research applications of recombinant R. meliloti atpB require specialized expression systems optimized for specific experimental goals. The following table outlines the most appropriate expression platforms for various research contexts:

Research ApplicationRecommended Expression SystemKey AdvantagesSpecial Considerations
Structural StudiesE. coli C41/C43(DE3) with pET vectors- High protein yield
- Compatible with isotope labeling
- Established protocols for membrane proteins
- Requires fusion partners (MBP, SUMO)
- Low-temperature induction (16°C)
- Addition of stabilizing agents (glycerol, specific lipids)
Functional CharacterizationE. coli FoF1-ATP synthase knockout strains- Allows complementation studies
- Enables in vivo activity assessment
- Eliminates background from host ATP synthase
- Lower expression yields
- May require codon optimization
- Growth rate monitoring as functional readout
Interaction StudiesBacillus subtilis- Closer to native membrane environment
- Better folding of membrane proteins
- Compatible with dual-tagging approaches
- More complex genetic manipulation
- Requires specialized expression vectors
- Different preferred codon usage
Large-Scale Protein ProductionInsect Cell/Baculovirus System- Superior folding of complex proteins
- Post-translational modification capability
- Higher yield of functional protein
- Higher cost
- Longer production timeline
- More complex purification requirements
In vitro ReconstitutionCell-Free Expression Systems- Direct incorporation into liposomes/nanodiscs
- Avoids inclusion body formation
- Rapid screening of multiple constructs
- Expensive components
- Lower yields
- Requires optimized reaction conditions
Mutagenesis StudiesRhizobium meliloti Expression System- Native cellular environment
- Authentic processing and folding
- Direct assessment of physiological effects
- Slower growth rate
- Fewer genetic tools available
- Lower protein yields

Expression System-Specific Optimizations:

  • E. coli-Based Expression:

    • Vectors: pET28a for N-terminal His-tag , pBAD for tighter regulation

    • Media: Terrific Broth supplemented with 0.4% glucose and 5 mM MgSO₄

    • Induction: 0.1-0.3 mM IPTG at OD₆₀₀ = 0.8-1.0, followed by 16-20°C overnight expression

    • Membrane extraction: Osmotic shock or gentle lysis procedures

  • Cell-Free Expression:

    • Supplement with lipids (E. coli polar lipids) or detergents (DDM, Brij-58)

    • Add disulfide isomerases for correct disulfide bond formation

    • Include molecular chaperones (GroEL/GroES) to assist folding

  • Homologous Expression in R. meliloti:

    • Use broad-host-range vectors like pBBR1MCS or pSRK

    • Optimize promoters for appropriate expression levels

    • Consider chromosomal integration for stable expression

The choice of expression system should be guided by the specific experimental goals, resource availability, and required protein authenticity. For applications where protein folding is critical, insect cell or homologous expression systems are preferred despite their higher complexity .

How can isotope labeling be used to study R. meliloti atpB structure and dynamics?

Isotope labeling represents a powerful approach for studying the structure and dynamics of R. meliloti atpB, enabling sophisticated NMR spectroscopy and mass spectrometry-based analyses of this important membrane protein:

NMR Spectroscopy Applications:

  • Uniform ¹⁵N-Labeling:

    • Expression in M9 minimal media with ¹⁵NH₄Cl as the sole nitrogen source

    • Enables ¹H-¹⁵N HSQC experiments for backbone assignment

    • Allows monitoring of protein folding and ligand binding

    • Provides information on local dynamics through relaxation measurements

  • Selective ¹³C-Labeling:

    • Expression with specific ¹³C-labeled amino acids or carbon sources

    • Facilitates assignment in larger proteins

    • Enables measurement of specific distances and angles

    • Reduces spectral complexity for membrane proteins

  • Deuteration Strategies:

    • Growth in D₂O-based media to replace non-exchangeable protons with deuterium

    • Improves spectral quality for larger proteins by reducing dipolar broadening

    • Transverse relaxation-optimized spectroscopy (TROSY) for membrane proteins

    • Selective protonation of methyl groups in a deuterated background

Mass Spectrometry Applications:

  • Hydrogen-Deuterium Exchange (HDX-MS):

    • Exposes protein to D₂O buffer for various time periods

    • Measures backbone amide hydrogen exchange rates

    • Identifies solvent-exposed regions versus protected core

    • Maps structural changes upon ligand binding or protein-protein interactions

  • Crosslinking Mass Spectrometry (XL-MS):

    • Introduces isotopically labeled crosslinkers (e.g., ¹²C/¹³C-labeled DSS)

    • Provides distance constraints between specific residues

    • Maps protein-protein interaction interfaces

    • Validates structural models of multi-domain arrangements

  • Limited Proteolysis with MS Detection:

    • Isotopically labeled protein reveals protected regions

    • Identifies domain boundaries and flexible regions

    • Monitors conformational changes in different functional states

Specialized Approaches for Membrane Proteins:

  • Cell-Free Expression with ¹⁹F-Labeled Amino Acids:

    • Incorporation of ¹⁹F-labeled amino acids at specific positions

    • ¹⁹F NMR provides highly sensitive probes of local environment

    • Monitors conformational changes during function

    • Works well even for large membrane protein complexes

  • Segmental Isotope Labeling:

    • Expression of isotopically labeled domains joined to unlabeled regions

    • Focuses analysis on regions of interest

    • Reduces spectral complexity

    • Applicable using split-intein approaches

  • Solid-State NMR with Magic-Angle Spinning:

    • Compatible with lipid-reconstituted membrane proteins

    • Provides structural information in a native-like environment

    • Measures interatomic distances and torsion angles

    • Reveals dynamics across multiple timescales

These techniques provide complementary information about atpB structure and dynamics and can be tailored to specific research questions. Experience with ATP-binding proteins in related systems has demonstrated the value of these approaches for understanding structure-function relationships . Implementation requires careful optimization of expression systems to achieve sufficient incorporation of isotopes while maintaining protein folding and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.