Recombinant Rhizobium meliloti ATP synthase subunit b/b' (atpG)

What is the molecular structure and function of ATP synthase subunit b/b' in Rhizobium meliloti?

ATP synthase subunit b/b' (atpG) in Rhizobium meliloti is a critical component of the bacterial F-type ATP synthase complex. This protein functions within the F0 sector of ATP synthase and plays an essential role in energy transduction. The full amino acid sequence consists of 204 amino acids, beginning with MFVTAAYAQSSTTEGAEAHDAAAAGEVHTETGVAHEADHGAGVFPPFDTTHFASQLLWLAITFGLFYLLMSKVIIPRIGGILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGAR and continuing through to the C-terminus .

The protein is also known by alternative names including ATP synthase F(0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', or simply F-ATPase subunit b/b' . Within the genome, the protein is encoded by the atpG gene (synonymous with atpF2), which is located at the ordered locus R00837 (ORF: SMc00869) . The functional role of this subunit involves participating in proton translocation and connecting the F0 and F1 sectors of ATP synthase, thereby facilitating ATP production through oxidative phosphorylation.

How do mutations in atpG affect cellular metabolism in Rhizobium meliloti?

Mutations in the atpG gene can have profound effects on cellular metabolism in Rhizobium meliloti. Research has shown that mutations in atpG directly impact ATP synthase activity and consequently affect multiple downstream metabolic pathways. Specifically, mutations in atpG resulting in truncation of the γ subunit of ATP synthase by 28-40 amino acids at the carboxyl terminus have been observed to significantly reduce both ATP synthase activity and phosphoenolpyruvate carboxykinase (Pck) expression .

These mutations lead to several metabolic consequences, including:

• Reduced growth yields in affected strains compared to wild-type bacteria

• Inability to utilize succinate as a carbon source (Suc- phenotype)

• Decreased phosphoenolpyruvate carboxykinase (Pck) activity, which impairs gluconeogenesis

• Altered energy state within the cell due to reduced ATP synthesis capability

• Potential disruption of proton gradient across the membrane

The relationship between atpG mutations and Pck activity suggests that ATP synthase functionality plays a crucial regulatory role in stationary phase metabolism, potentially through several mechanisms including energy availability, intracellular pH regulation, or protein phosphorylation cascades .

What are the optimal storage conditions for recombinant Rhizobium meliloti ATP synthase subunit b/b'?

For optimal preservation of recombinant Rhizobium meliloti ATP synthase subunit b/b' protein activity, storage conditions must be carefully controlled. Based on empirical evidence, the following protocol is recommended:

For short-term storage (up to one week): Store working aliquots at 4°C in Tris-based buffer containing 50% glycerol, optimized specifically for this protein .

For extended storage: Maintain the protein at -20°C, or preferably at -80°C for maximum stability. The protein should be stored in small aliquots to minimize freeze-thaw cycles .

Important handling considerations:

• Repeated freezing and thawing significantly reduces protein activity and should be strictly avoided

• When preparing working aliquots, maintain cold chain procedures to preserve structural integrity

• Storage buffer composition (Tris-based with 50% glycerol) has been optimized specifically for this protein to maintain stability

These storage protocols have been established to preserve both structural integrity and functional activity of the recombinant protein for research applications.

How can genetic engineering strategies be applied to modify atpG expression in Rhizobium meliloti?

Several sophisticated genetic engineering approaches can be employed to modify atpG expression in Rhizobium meliloti, each with specific methodological considerations:

Site-Specific Recombination Systems

λ Integrase-Mediated Recombination:
This method utilizes the λ integrase system to facilitate precise genetic modifications. In practical application with S. meliloti, researchers have successfully employed BP Clonase enzyme cocktail containing λ integrase and E. coli IHF to construct recombinant strains . The methodology involves:

• Generation of PCR products of the target gene (such as atpG) flanked by attB sites

• Incorporation into a plasmid containing attP sites

• Integration through site-specific recombination between attB and attP sites

• Selection using counter-selectable markers (such as ccdB toxin gene)

ΦC31 Integrase System:
The ΦC31 large serine recombinase offers advantages over Cre-loxP systems and λ integrase by functioning bidirectionally without requiring accessory proteins. For atpG modifications, this system utilizes:

• Recognition sequences: attB (34 bp, 5′-GTGCCAGGGCGTGCCCTTGGGCTCCCCGGGCGCG) and attP (39 bp, 5′-CCCCAACTGGGGTAACCTTTGAGTTCTCTCAGTTGGGGG)

• "Landing pad" integration incorporating markers (e.g., spectinomycin-resistance)

• Cassette exchange methodology for targeted gene replacement

CRISPR/Cas-Based Editing

CRISPR/Cas systems have been adapted for S. meliloti genome editing, providing unprecedented precision for atpG modifications. Implementation requires:

• Design of guide RNAs specifically targeting atpG sequences

• Selection of appropriate Cas variant (typically Cas9 or Cas12a)

• Construction of targeting vectors with homology arms flanking desired modification sites

• Delivery system optimization (typically conjugation-based for S. meliloti)

• Screening strategies to identify successful edits

These genetic engineering approaches can be applied to create specific atpG variants for structure-function studies, expression modulation, or protein tagging for localization analyses.

What are the phenotypic consequences of atpG truncation mutations in Rhizobium meliloti?

Truncation mutations in the atpG gene of Rhizobium meliloti produce distinct phenotypic consequences with significant implications for bacterial physiology. Detailed analyses have revealed:

Identified Mutation Types and Their Molecular Consequences

Phenotypic Effects

These truncation mutations result in multifaceted phenotypic changes:

• Growth Characteristics:

  • Significant reduction in growth yield compared to wild-type strains

  • Inability to utilize succinate as a carbon source (Suc- phenotype)

  • Growth defects that cannot be attributed solely to slow growth rate

• Enzymatic Activities:

  • Markedly reduced ATP synthase activity (direct consequence)

  • Significantly decreased phosphoenolpyruvate carboxykinase (Pck) activity

  • Functional link between ATP synthase and gluconeogenesis pathway regulation

• Genetic Characteristics:

  • Frequently associated with kanamycin resistance (KanR)

  • Normal fermentation capabilities for maltose and arabinose (indicating intact cya/crp pathways)

• Complementation Properties:

  • Phenotypes can be restored by plasmids expressing the complete atp operon

  • Selective complementation possible with plasmids expressing only the F1 region of ATP synthase

  • Specific atpG expression restores normal phenotype in affected strains

The observed phenotypic consequences indicate that the C-terminal region of the γ subunit is critical for proper ATP synthase function and suggest this region may function as a proton flow gate that links ATP synthesis to proton translocation across the membrane .

How does atpG influence phosphoenolpyruvate carboxykinase (Pck) expression in stationary phase?

The relationship between atpG and phosphoenolpyruvate carboxykinase (Pck) expression represents a complex regulatory connection with significant implications for stationary phase metabolism. Multiple mechanistic models have been proposed based on experimental evidence:

Energy State Regulation Model

Gluconeogenesis is an energy-intensive metabolic pathway. Mutations in atpG that compromise ATP synthase function result in reduced cellular ATP levels, creating a low-energy state that may directly downregulate Pck expression through:

• Energy-sensing transcription factors that respond to ATP:ADP ratios

• Allosteric regulation of enzymes involved in Pck production

• Post-translational modifications dependent on cellular energy status

Experimental evidence supporting this model includes the observation that ATP synthase-deficient mutants show consistently lower Pck specific activity throughout growth phases compared to wild-type strains .

Proton Gradient Disruption Model

The γ subunit (encoded by atpG) functions as a critical gate for proton flow in ATP synthase. Truncation mutations may convert ATP synthase into an uncoupled proton pore, leading to:

• Collapse of the transmembrane proton gradient

• Disruption of pH-dependent signaling pathways

• Altered membrane potential affecting numerous cellular processes

This model is supported by the finding that specific truncations of 28-40 amino acids at the C-terminus of the γ subunit produce the observed phenotypes, suggesting structural changes that specifically affect proton coupling .

Intracellular pH Regulation Model

ATP synthase activity influences intracellular pH, which may directly affect Pck:

• Pck synthesis or activity may be pH-dependent

• Transcriptional regulators of pckA may respond to pH changes

• Similar pH-responsive gene regulation has been documented for genes like ompF, lamB, and the mar operon

Protein Phosphorylation Model

ATP synthase may participate in regulatory protein phosphorylation cascades:

• ATP synthase might interact with or function as a protein kinase

• Phosphorylation state of regulatory proteins may influence pckA expression

• Signal transduction pathways linking energy status to gene expression

These mechanisms are not mutually exclusive, and the regulation likely involves multiple interconnected pathways. The discovery of this link between atpG and pckA opens new avenues for investigating stationary phase regulation of gluconeogenesis in Rhizobium meliloti.

What techniques are effective for purifying recombinant Rhizobium meliloti ATP synthase subunit b/b'?

Purification of recombinant Rhizobium meliloti ATP synthase subunit b/b' requires specialized techniques that address the unique characteristics of this membrane-associated protein. Based on established protocols, the following methodological approach is recommended:

Expression System Selection

For optimal expression of functional atpG protein:

• Escherichia coli BL21(DE3) or similar expression strains are preferred hosts

• Expression vectors incorporating T7 or similar strong inducible promoters

• Fusion tags may be incorporated based on experimental requirements (the tag type is typically determined during the production process)

• Temperature-regulated expression (typically 18-25°C) to enhance proper folding

Purification Strategy

A multi-step purification approach yields highest purity:

• Initial Extraction:

  • Cell lysis via sonication or French press in Tris-based buffer

  • Differential centrifugation to separate membrane and soluble fractions

  • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

• Affinity Chromatography:

  • Immobilized metal affinity chromatography (if His-tagged)

  • Other affinity methods based on fusion tag employed

  • Stringent washing steps to remove contaminants

• Secondary Purification:

  • Ion exchange chromatography

  • Size exclusion chromatography for final polishing

  • Concentration by ultrafiltration

• Quality Control:

  • SDS-PAGE analysis for purity assessment

  • Western blotting for identity confirmation

  • Mass spectrometry for structural verification

  • Functional assays to confirm biological activity

The purified protein should be stored in Tris-based buffer containing 50% glycerol at -20°C for short-term storage or -80°C for extended storage, with aliquoting to prevent freeze-thaw cycles .

How can mutations in atpG be identified and characterized in Rhizobium meliloti?

Identification and characterization of atpG mutations in Rhizobium meliloti requires a systematic approach combining genetic, biochemical, and functional analyses:

Genetic Screening Strategies

Phenotypic Selection:

• Screen for Succinate-negative (Suc-) phenotype on minimal media with succinate as sole carbon source

• Select for kanamycin-resistant (KanR) mutants (commonly associated with atpG mutations)

• Verify that mutants retain ability to ferment maltose and arabinose (distinguishing from cya/crp mutations)

Genetic Mapping:

• Perform P1 transduction to test linkage to genetic markers near the atp operon

• Test linkage to ilvD and rbs loci, which are proximal to the atp operon

• Complementation testing with wild-type atp operon on plasmids

Molecular Characterization

PCR and Sequencing:

• Amplify the atpG region using primers flanking the gene

  • Forward primer design should include upstream regulatory regions

  • Reverse primer should extend beyond the coding sequence

• Sequence PCR products to identify specific mutations

• Compare with wild-type sequence to identify deletions, insertions, or point mutations

Expression Analysis:

• Quantitative RT-PCR to assess atpG transcript levels

• Western blotting to evaluate γ subunit protein expression

• Analysis of protein truncation or modification using mass spectrometry

Functional Characterization

Enzyme Activity Assays:

• Measure ATP synthase activity using established protocols:

  • Membrane preparation from bacterial cultures

  • Spectrophotometric assays coupling ATP hydrolysis to NADH oxidation

  • Calculation of specific activity relative to wild-type controls

• Assess Pck activity to establish correlation with atpG mutation:

  • Cell-free extract preparation

  • Assay for Pck activity measuring OAA to PEP conversion

  • Data normalization to protein concentration

Complementation Studies:

• Transform mutants with plasmids expressing:

  • Complete atp operon

  • F1 portion of ATP synthase

  • Specific atpG gene

• Assess restoration of:

  • Succinate utilization

  • ATP synthase activity

  • Pck activity

  • Growth characteristics

This comprehensive approach has successfully identified specific mutations in atpG, including two-base pair "GC" deletions and single "T" deletions resulting in C-terminal truncations of the γ subunit by 28-40 amino acids .

What control experiments should be included when studying the effects of atpG mutations on bacterial metabolism?

When investigating the effects of atpG mutations on bacterial metabolism, rigorous control experiments are essential to ensure data validity and accurate interpretation. The following experimental controls should be implemented:

Genetic Controls

Strain Verification:

• Whole-genome sequencing of mutant strains to confirm atpG mutation and rule out secondary mutations

• PCR verification of the atpG locus in all experimental strains

• Construction of isogenic strains differing only in the atpG locus

Complementation Controls:

• Empty vector controls to distinguish specific complementation from vector effects

• Partial complementation with F1 region to determine subunit-specific effects

• Wild-type atpG expression to confirm phenotype restoration is specific to the atpG mutation

• Heterologous expression of ATP synthase subunits from related organisms

Growth Condition Controls

Growth Medium Variations:

• Minimal media with different carbon sources (glucose, succinate, etc.)

• Rich media to assess general growth capabilities

• Media with varying pH to test pH-dependent effects

Growth Phase Controls:

• Sampling at multiple points throughout growth curve

• Specific analysis of stationary phase effects

• Comparison of lag, exponential, and stationary phase data

Metabolic Controls

Energy Status Assessment:

• Measurement of ATP:ADP ratios in mutant and wild-type strains

• Determination of intracellular pH using fluorescent probes

• Assessment of membrane potential using appropriate indicators

Pathway-Specific Controls:

• Analysis of strains with mutations in related but distinct metabolic pathways

• Inclusion of pps+ background strains to assess pathway-specific effects

• Evaluation of alternative ATP-generating systems

Experimental Control Table

Implementation of these controls has been demonstrated to effectively isolate the specific effects of atpG mutations from confounding variables, allowing for more precise interpretation of the relationship between ATP synthase function and bacterial metabolism .

What are the latest genetic engineering advances for studying ATP synthase in Rhizobium meliloti?

Recent developments in genetic engineering technologies have significantly enhanced our capacity to study ATP synthase in Rhizobium meliloti. Several cutting-edge approaches have emerged:

CRISPR/Cas System Adaptations

CRISPR/Cas technology has been successfully adapted for precise genetic manipulation in S. meliloti, offering unprecedented control for ATP synthase studies:

• Multiple CRISPR/Cas variants have been optimized for S. meliloti, allowing for:

  • Base pair-level editing precision

  • Multiplexed gene targeting

  • Non-homologous end joining (NHEJ) and homology-directed repair (HDR) approaches

• System-specific optimizations include:

  • S. meliloti-compatible promoters for guide RNA expression

  • Codon-optimized Cas nucleases

  • Delivery systems tailored to rhizobial transformation efficiency

Site-Specific Recombination Systems

Advanced recombination systems provide efficient tools for studying specific ATP synthase subunits:

• ΦC31 Integrase System:

  • Enables cassette exchange without leaving selection markers

  • Creates stable genetic modifications without antibiotic selection

  • Facilitates sequential genetic modifications at multiple genomic loci

• λ Integrase Recombination Method:

  • Combines PCR products of target genes flanked by attB sites

  • Incorporates into attP sites in plasmids

  • Utilizes counter-selectable markers like ccdB for efficient selection

These technologies enable precise manipulation of individual ATP synthase subunits, facilitating structure-function studies with unprecedented resolution and efficiency.

Future Technological Directions

Emerging approaches with significant potential include:

• In vivo protein labeling systems for real-time visualization of ATP synthase assembly and dynamics

• Conditional expression systems for temporal control of ATP synthase subunit expression

• Integration of multi-omics approaches to comprehensively characterize ATP synthase function in different environmental conditions

These technological advances provide researchers with sophisticated tools to explore the intricate functions and regulatory mechanisms of ATP synthase in Rhizobium meliloti.

How does atpG structure-function relationship in Rhizobium meliloti compare to other bacterial species?

The structure-function relationship of atpG (encoding the γ subunit of ATP synthase) in Rhizobium meliloti exhibits both conserved features and unique characteristics when compared to other bacterial species:

Conserved Structural Features

The γ subunit serves as the central rotary shaft in F1F0-ATP synthase across bacterial species, with several highly conserved domains:

• N-terminal domain containing the bearing surface that interacts with the α3β3 hexamer

• Central coiled-coil region forming the shaft of the rotor

• C-terminal domain that interacts with the c-ring in the membrane-embedded F0 sector

In R. meliloti, as in other bacteria, the γ subunit functions as the critical link between proton translocation through F0 and ATP synthesis/hydrolysis in F1 .

Species-Specific Variations

Analysis of the atpG sequence in R. meliloti reveals several distinctive features:

• The amino acid sequence MFVTAAYAQSSTTEGAEAHDAAAAGEVHTET... shows specific residue variations compared to other bacterial species, particularly in the N-terminal region

• Truncation mutations affecting 28-40 amino acids at the C-terminus in R. meliloti result in:

  • Loss of ATP synthase activity

  • Inability to utilize succinate

  • Reduced Pck activity

These effects suggest that the C-terminal region of the γ subunit in R. meliloti has evolved specific functional properties that may differ from other bacteria.

Comparative Analysis Table

The unique properties of the R. meliloti γ subunit, particularly the sensitivity of its C-terminal region to truncation and its specific effects on Pck activity, suggest that while the fundamental rotary mechanism is conserved, the regulatory functions and metabolic integration of ATP synthase have evolved distinct features in this nitrogen-fixing symbiont.

What are the implications of atpG research for understanding bacterial adaptation to environmental stresses?

Research on atpG in Rhizobium meliloti has significant implications for understanding bacterial adaptation to environmental stresses, especially in the context of symbiotic nitrogen fixation and soil microbial ecology:

Energy Homeostasis Under Stress Conditions

ATP synthase, and specifically the γ subunit encoded by atpG, plays a crucial role in maintaining energy homeostasis during environmental challenges:

• pH Stress Adaptation:

  • The γ subunit functions as a proton flow gate that may help bacteria maintain intracellular pH homeostasis under acidic soil conditions

  • Mutations in atpG affect the expression of multiple genes regulated by pH, suggesting a broader role in pH adaptation

  • This mechanism may be particularly important in acidic soil environments where rhizobia must maintain function

• Nutrient Limitation Responses:

  • The connection between atpG mutations and phosphoenolpyruvate carboxykinase (Pck) expression links ATP synthase function to gluconeogenesis regulation

  • This relationship likely represents an adaptive mechanism to coordinate energy production with carbon metabolism during nutrient-limited conditions

  • Such coordination is essential for survival during the transition to stationary phase when nutrients become scarce

Symbiotic Interactions

The function of ATP synthase in R. meliloti has direct implications for its symbiotic relationship with leguminous plants:

• Nodulation Efficiency:

  • Energy production is critical during the establishment of symbiosis

  • Proper ATP synthase function may influence bacterial persistence in the rhizosphere

  • The specific regulatory connections between ATP synthesis and carbon metabolism may be crucial during bacteroid differentiation

• Nitrogen Fixation Capacity:

  • Nitrogen fixation is an energy-intensive process requiring efficient ATP production

  • ATP synthase functionality directly impacts the energy available for nitrogenase activity

  • Metabolic coordination through ATP synthase may help balance the energy demands of nitrogen fixation with cellular maintenance

Ecological and Agricultural Implications

Understanding atpG function has broader implications for soil ecology and sustainable agriculture:

• Soil Adaptation Mechanisms:

  • ATP synthase modifications may represent evolutionary adaptations to specific soil conditions

  • The regulatory role of the γ subunit might contribute to niche specialization of different rhizobial strains

  • This knowledge could inform selection of rhizobial inoculants for specific soil conditions

• Agricultural Applications:

  • Insights into energy metabolism regulation could lead to improved rhizobial strains with enhanced stress tolerance

  • Understanding the link between ATP synthesis and carbon metabolism may help develop strategies to improve symbiotic efficiency

  • This research contributes to the fundamental knowledge needed for engineering more effective plant-microbe interactions for sustainable agriculture

The study of atpG thus provides crucial insights into the molecular mechanisms underlying bacterial adaptation to environmental stresses, with significant implications for both basic microbial ecology and applied agricultural microbiology.

What are the key knowledge gaps in current understanding of Rhizobium meliloti ATP synthase subunit b/b' (atpG)?

Despite significant advances in our understanding of Rhizobium meliloti ATP synthase subunit b/b' (atpG), several critical knowledge gaps remain that represent important opportunities for future research:

Structural Details and Dynamics

A comprehensive structural characterization of R. meliloti ATP synthase, particularly the b/b' and γ subunits, remains incomplete. Specific knowledge gaps include:

• High-resolution structures of the complete R. meliloti ATP synthase complex

• Dynamic interactions between the b/b' subunits and other components during catalytic cycles

• Conformational changes in the γ subunit during proton translocation specific to R. meliloti

These structural details are essential for understanding the unique functional aspects of ATP synthase in this organism, particularly in relation to the observed effects of C-terminal truncations on enzyme function.

Regulatory Networks and Signaling

The mechanisms connecting ATP synthase function to broader metabolic regulation require further elucidation:

• The specific molecular pathway linking atpG function to pckA expression remains incompletely characterized

• Potential protein-protein interactions between ATP synthase components and regulatory factors

• Signal transduction pathways that may sense ATP synthase activity status and transmit this information to transcriptional machinery

Research in this area would clarify how energy production is coordinated with carbon metabolism and other cellular processes in response to environmental changes.

Symbiotic Context

The role of ATP synthase in the specific context of the Rhizobium-legume symbiosis remains underexplored:

Understanding these aspects would provide valuable insights into the energetics of this agriculturally important symbiosis.

Addressing these knowledge gaps would significantly advance our understanding of bacterial bioenergetics, metabolic regulation, and symbiotic relationships, with potential applications in agriculture and biotechnology.

How might understanding of atpG contribute to biotechnological applications involving Rhizobium meliloti?

The detailed understanding of atpG structure, function, and regulation in Rhizobium meliloti offers several promising avenues for biotechnological applications:

Enhanced Biofertilizer Development

Knowledge of ATP synthase function in R. meliloti provides opportunities for developing improved biofertilizers:

• Engineering strains with optimized energy production for more efficient nitrogen fixation

• Creating variants with enhanced tolerance to soil acidity through modifications of ATP synthase components

• Developing strains with improved carbon metabolism coordination for better survival in agricultural soils

These applications could significantly contribute to sustainable agriculture by reducing dependence on chemical fertilizers while improving crop yields.

Metabolic Engineering for Bioproduction

R. meliloti has potential as a platform for producing high-value compounds, with ATP synthase engineering playing a key role:

• Optimization of energy metabolism for production of vitamin B12 and other nutritional compounds

• Engineering of ATP synthase efficiency to support enhanced metabolic flux through desired pathways

• Creation of strains with altered carbon flux patterns through modulating the ATP synthase-gluconeogenesis regulatory connection

The natural capacity of S. meliloti to produce valuable compounds, combined with its genetic tractability, makes it an attractive candidate for such applications.

Biosensor Development

The connection between ATP synthase function and specific metabolic pathways could be exploited for biosensor creation:

• Development of whole-cell biosensors using ATP synthase-regulated reporter systems

• Creation of diagnostic tools for soil health assessment based on rhizobial energy metabolism

• Engineering of reporter strains that respond to specific environmental conditions through ATP synthase-mediated signaling

Such biosensors could provide valuable tools for agricultural diagnostics and environmental monitoring.

Model Systems for Understanding Bacterial Bioenergetics

R. meliloti ATP synthase research contributes to fundamental understanding with broader applications:

• Serving as a model for understanding bacterial adaptation to environmental stresses

• Providing insights into the coordination of energy production with carbon metabolism

• Offering a system for studying the evolution of protein complexes in bacteria with complex lifestyles

The knowledge gained from R. meliloti ATP synthase studies may inform similar approaches in other bacteria of industrial or medical importance, exemplifying how fundamental research can drive biotechnological innovation.