Recombinant Rhizobium meliloti Beta- (1-->2)glucan export ATP-binding/permease protein NdvA

Shipped with Ice Packs
In Stock

Description

Glucan Export Mechanism

  • Cyclic β-(1→2)-glucans are synthesized in the periplasm under low-osmolarity conditions and require NdvA for export .

  • Mutants lacking ndvA fail to export glucans, leading to:

    • Symbiotic defects: Small, non-functional nodules on alfalfa roots .

    • Vegetative impairments: Reduced motility and osmotic sensitivity .

ATP-Dependent Transport

  • NdvA hydrolyzes ATP to energize glucan translocation across the inner membrane .

  • The absence of NdvA results in intracellular accumulation of glucans, despite the presence of a 235 kDa membrane-bound glucan synthesis intermediate .

Table 2: Phenotypic Comparison of Wild-Type vs. ndvA Mutants

ParameterWild-TypendvA Mutant
Extracellular glucansPresent (≥35% modified with phosphoglycerol) Absent
Nodule developmentFunctional (nitrogen-fixing)Non-functional ("empty" nodules)
OsmoadaptationTolerates low osmolarityHypersensitive

Production in E. coli

  • Recombinant NdvA is expressed as a full-length protein (1–588 amino acids) with an N-terminal His tag for purification .

  • Purity: >90% (verified by SDS-PAGE) .

  • Storage: Stable in Tris/PBS buffer with 6% trehalose at -80°C .

Research Applications

  • Symbiosis studies: Used to dissect glucan’s role in legume infection .

  • Structural biology: Homology modeling to understand ATP-binding transport mechanisms .

  • Biotechnology: Potential applications in improving nitrogen-fixing efficiency in crops .

Key Research Findings

  • Pseudorevertant analysis: Second-site mutations restoring partial symbiosis in ndvA mutants occur without glucan export recovery, suggesting alternative pathways for nodulation .

  • Evolutionary conservation: The ndvA locus can functionally substitute for chvA in Agrobacterium tumefaciens, highlighting its role in bacterial pathogenesis and symbiosis .

Unresolved Questions

  • Regulatory mechanisms: How osmotic conditions regulate NdvA activity.

  • Glucan modification: Role of phosphoglycerol substituents in nodule signaling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid formulations is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
ndvA; R03283; SMc03900; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
ndvA
Target Protein Sequence
MSLFQVYARALQYLAVHKFRVGAIVIANIVLAAITIAEPILFGRIIDAISSQKDVAPMLL LWAGFGVFNTIAFVLVSREADRLAHGRRASLLTEAFGRIVSMPLSWHSQRGTSNALHTLL RACETLFGLWLEFMRQHLATAVALMLLIPTAFAMDVRLSLILVVLGAAYVMISKVVMSRT KEGQAAVEGHYHTVFSHVSDSISNVSVVHSYNRIEAETRELKKFTQRLLSAQYPVLDWWA LASGLNRIASTISMMAILVIGTVLVQRGELGVGEVIAFIGFANLLIGRLDQMKAFATQIF EARAKLEDFFQLEDSVQDREEPADAGELKGVVGEVEFRDISFDFANSAQGVRNVSFKAKA GQTIAIVGPTGAGKTTLVNLLQRVHEPKHGQILIDGVDIATVTRKSLRRSIATVFQDAGL MNRSIGENIRLGREDASLDEVMAAAEAAAASDFIEDRLNGYDTVVGERGNRLSGGERQRV AIARAILKNAPILVLDEATSALDVETEARVKDAIDALRKDRTTFIIAHRLSTVREADLVI FMDQGRVVEMGGFHELSQSNGRFAALLRASGILTDEDVRKSLTAA
Uniprot No.

Target Background

Function
The NdvA protein plays a crucial role in the export of beta-(1->2)glucan, essential for nodulation in legume roots. It may also be involved in the export of other oligosaccharides. The transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for generating energy (probable).
Database Links
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of NdvA protein in Rhizobium meliloti?

NdvA is a 67,100-dalton protein composed of 616 amino acid residues, encoded by a single large open reading frame in the ndvA locus. The protein shares significant homology with bacterial ATP-binding transport proteins, most notably with Escherichia coli HlyB (28.2% identity over a 589-amino-acid sequence overlap), which is involved in hemolysin export . The homology is particularly strong (45.6% identity) in the region associated with ATP binding (amino acid residues 358-616) .

For structural characterization, researchers should employ:

  • X-ray crystallography or cryo-electron microscopy to determine three-dimensional configuration

  • Comparative sequence analysis (BLAST, Clustal Omega) to identify conserved domains

  • Structural modeling of ATP-binding domains using computational tools

  • Hydropathy analysis to identify potential membrane-spanning regions

The protein's hydropathy profile reveals alternating hydrophobic and hydrophilic regions consistent with its function as a membrane-associated export protein .

How does NdvA function in β-(1→2)glucan export?

NdvA functions as an essential component in the export pathway of β-(1→2)glucan from Rhizobium meliloti cells. Experimental evidence indicates that ndvA mutants retain an active 235,000-dalton membrane protein intermediate involved in β-(1→2)glucan synthesis but lack extracellular β-(1→2)glucan . This finding strongly suggests that NdvA specifically facilitates the transport of synthesized glucan across the cell membrane to the extracellular environment rather than participating in the synthesis process itself.

To investigate this function methodologically:

  • Isolate periplasmic and extracellular fractions from wild-type and ndvA mutant strains to compare β-(1→2)glucan content

  • Conduct size profiling of neutral carbohydrates from cell and supernatant fractions using gel filtration chromatography

  • Develop membrane vesicle studies combining purified NdvA with radiolabeled β-(1→2)glucan to observe transport in vitro

  • Use fluorescently tagged β-(1→2)glucan to track export dynamics in real-time

The proposed export function aligns with NdvA's homology to bacterial ATP-binding export proteins and its predicted membrane topology .

What is the relationship between NdvA and related bacterial export proteins?

NdvA belongs to a family of ATP-binding transport proteins with homologs across multiple bacterial genera. The ndvA locus of R. meliloti is functionally equivalent to the chvA locus of Agrobacterium tumefaciens; the ndvA locus can complement chvA mutants, restoring their function . This cross-species complementation demonstrates remarkable functional conservation despite the different ecological niches these bacteria occupy (symbiont vs. pathogen).

Key relationships include:

  • Highest homology with E. coli HlyB (hemolysin export protein)

  • Significant similarity to the mdr gene product of mammalian cells (46.3% and 38.7% identity in regions surrounding ATP-binding sites)

  • Functional equivalence to A. tumefaciens ChvA

For comparative analysis, researchers should:

  • Create phylogenetic trees of related ABC transporters

  • Perform domain-specific alignments focusing on ATP-binding regions

  • Conduct cross-species complementation experiments

  • Investigate structural determinants of substrate specificity

Understanding these evolutionary relationships provides insights into the conservation of molecular transport mechanisms across bacterial species with diverse lifestyles .

What are the optimal methods for expressing and purifying recombinant NdvA?

Successful expression and purification of recombinant NdvA requires careful consideration of several factors:

Expression systems:

  • E. coli is commonly used, though yeast, baculovirus, or mammalian cell systems may be appropriate depending on research goals

  • For E. coli expression, BL21(DE3) strains often yield good results for membrane proteins

Expression vector design:

  • Include affinity tags (His6 or GST) for purification

  • Consider codon optimization for the expression host

  • Use inducible promoters (T7 or tac) for controlled expression

Purification protocol:

  • Isolate membrane fractions through differential centrifugation

  • Solubilize membranes with appropriate detergents (n-dodecyl-β-D-maltoside or CHAPS)

  • Perform affinity chromatography using the incorporated tag

  • Conduct size exclusion chromatography for final purification

  • Store in buffer containing glycerol for stability preservation

Quality control:

  • Verify purity (>90% recommended) by SDS-PAGE

  • Confirm identity through Western blotting and mass spectrometry

  • Assess functional activity through ATP binding assays

Researchers should optimize each step for NdvA specifically, as membrane proteins often require customized conditions for successful expression and purification.

How can researchers effectively study ATP binding and hydrolysis by NdvA?

To investigate NdvA's ATP-binding and hydrolysis properties, researchers should implement a multi-faceted approach:

Binding studies:

  • Equilibrium dialysis with [γ-32P]ATP to determine binding constants

  • Fluorescence-based assays using ATP analogs (TNP-ATP, MANT-ATP)

  • Surface plasmon resonance to measure binding kinetics

  • Isothermal titration calorimetry for thermodynamic parameters

Hydrolysis assays:

  • Colorimetric determination of inorganic phosphate release

  • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase system)

  • Thin-layer chromatography to separate ATP hydrolysis products

Mutational analysis:

  • Create alanine substitutions in conserved ATP-binding motifs

  • Focus on the region between amino acids 358-616, which shows high homology with known ATP-binding domains

  • Assess effects on both binding and hydrolysis activities

Structural studies:

  • Obtain structures in different nucleotide-bound states to capture conformational changes

  • Investigate coupling between ATP hydrolysis and transport function

This comprehensive approach will provide insights into how ATP binding and hydrolysis power the β-(1→2)glucan export process.

What genetic tools are most effective for creating and analyzing ndvA mutants?

Several genetic approaches can be employed to create and analyze ndvA mutants in R. meliloti:

Mutagenesis strategies:

  • Transposon mutagenesis using Tn5lac, as used to create strain LI1

  • Site-directed mutagenesis via overlap extension PCR

  • CRISPR-Cas9 genome editing for precise modifications

  • Construction of deletion series to map functional domains

Genetic mapping techniques:

  • Complementation analysis using plasmid-borne ndvA fragments

  • Creation of left- and right-end deletions to determine minimal functional regions

  • Insertion of reporter genes for expression analysis

Phenotypic characterization:

  • Assess β-(1→2)glucan production in cell and supernatant fractions

  • Evaluate symbiotic proficiency through nodulation assays

  • Measure growth characteristics in defined media

  • Examine membrane protein profiles using radiolabeling approaches

Advanced approaches:

  • Optogenetic control systems for conditional expression

  • Fluorescent protein fusions to monitor protein localization

  • Construction of chimeric proteins with related transporters

When designing mutants, researchers should create a panel that includes null mutants, point mutations in functional domains, and conditional expression constructs to comprehensively understand NdvA function.

How does NdvA activity influence nodule formation and development?

NdvA activity is critical for normal nodule formation and development in the Rhizobium-legume symbiosis. Evidence from ndvA mutants reveals a distinctive symbiotic phenotype:

Nodulation phenotype:

  • Mutations in ndvA result in delayed formation of numerous small white nodules distributed throughout the root system

  • These nodules are not invaded by mutant bacteria and consequently remain empty

  • The nodules fail to fix nitrogen, indicating arrested development at an early stage

Mechanistic analysis approaches:

  • Time-course studies of nodulation using wild-type and ndvA mutant strains

  • Histological examination of nodule sections to assess infection thread formation

  • Confocal microscopy with fluorescently labeled bacteria to visualize invasion patterns

  • Electron microscopy to examine bacteroid development

  • Transcriptomic analysis of both plant and bacterial genes during nodulation

Experimental design considerations:

  • Include multiple time points (24h, 48h, 72h, 1 week, 2 weeks post-inoculation)

  • Compare multiple ndvA mutant alleles to rule out secondary effects

  • Use complemented strains as positive controls

  • Implement optogenetic control systems to manipulate NdvA activity at specific developmental stages

Understanding how NdvA influences nodule development provides insights into the molecular basis of this agriculturally important symbiosis.

How can researchers investigate the specificity of NdvA's role compared to other ABC transporters?

To investigate the specificity of NdvA's role compared to other ABC transporters, researchers should employ several complementary approaches:

Comparative genomic analysis:

  • Construct phylogenetic trees of related ABC transporters across rhizobial species

  • Identify conserved and divergent sequence motifs

  • Analyze genomic context and operon structures

Domain-swapping experiments:

  • Create chimeric proteins exchanging domains between NdvA and other ABC transporters

  • Assess functionality through complementation of ndvA mutants

  • Determine which domains confer substrate specificity

Cross-species complementation:

  • Test whether transporters from other species can complement ndvA mutants

  • The established complementation between ndvA and chvA provides a precedent for this approach

  • Evaluate the degree of functional rescue

Substrate specificity profiling:

  • Develop in vitro transport assays with purified NdvA

  • Test a range of potential substrates beyond β-(1→2)glucan

  • Use competition assays to determine relative affinities

Co-expression analysis:

  • Identify genes co-regulated with ndvA under various conditions

  • Map protein-protein interactions to identify specific partners

  • Assess localization patterns compared to other transporters

This systematic approach will help delineate NdvA's unique functions compared to other members of the ABC transporter superfamily.

How can optogenetic approaches enhance the study of NdvA function?

Optogenetic approaches offer unprecedented temporal and spatial control over NdvA expression and activity, opening new research possibilities:

Implementation strategies:

  • Utilize light-responsive promoters (such as the El222 system mentioned in the search results) to control ndvA expression

  • Clone ndvA under the P El222_rbsD promoter-ribosome binding site combination in appropriate vectors

  • Express light-sensitive domains fused to NdvA for direct protein activation/inactivation

Research applications:

  • Precisely time ndvA expression during the symbiotic process to identify critical windows

  • Create spatial expression patterns in the rhizosphere to study localized effects

  • Implement reversible activation/inactivation to study the dynamics of β-(1→2)glucan export

  • Investigate plant responses to temporally controlled β-(1→2)glucan production

Experimental design:

  • Include appropriate light controls (wavelength, intensity, duration)

  • Develop imaging systems to monitor both light application and cellular responses

  • Create reporter constructs (such as sfGFP) to verify optogenetic system functionality

  • Compare results with conventional genetic approaches to validate findings

This cutting-edge approach enables researchers to address questions about NdvA function that were previously inaccessible with traditional genetic methods.

What approaches can reveal the dynamics of NdvA-mediated β-(1→2)glucan export?

Understanding the dynamics of NdvA-mediated β-(1→2)glucan export requires sophisticated techniques that capture the process in real-time:

Live-cell imaging approaches:

  • Fluorescently label β-(1→2)glucan using compatible dyes or click chemistry

  • Use FRAP (Fluorescence Recovery After Photobleaching) to measure export rates

  • Implement super-resolution microscopy to visualize export sites

Biochemical time-course studies:

  • Pulse-chase experiments with radiolabeled precursors

  • Rapid sampling and quenching techniques to capture intermediates

  • Separation of cellular compartments at defined time points

Biophysical methods:

  • Develop reconstituted systems with purified components

  • Use membrane vesicles to study transport directionality

  • Apply patch-clamp techniques if channel-like properties are suspected

Mathematical modeling:

  • Develop kinetic models of the export process

  • Simulate the effects of ATP concentration, substrate availability, and protein levels

  • Validate models with experimental data from wild-type and mutant strains

Genetic approaches:

  • Create conditional ndvA mutants for synchronized export studies

  • Use the optogenetic systems discussed previously for precise temporal control

  • Generate reporter strains that signal when export is active

These approaches collectively will provide a comprehensive view of how NdvA facilitates the export of β-(1→2)glucan across the bacterial membrane.

How can researchers distinguish between direct and indirect effects of ndvA mutations?

Distinguishing between direct and indirect effects of ndvA mutations requires methodological rigor and multiple lines of evidence:

Genetic approaches:

  • Conduct complementation analysis with wild-type ndvA and targeted mutants

  • Perform suppressor screens to identify genes that can bypass ndvA function

  • Create conditional mutants to observe immediate versus delayed effects

Biochemical methods:

  • Conduct in vitro reconstitution experiments with purified components

  • Perform protein-protein interaction studies to identify direct binding partners

  • Track metabolite changes immediately following ndvA inactivation

Temporal analysis:

  • Implement time-course studies after conditional inactivation

  • Use rapid sampling to capture early events post-mutation

  • Apply metabolic flux analysis to trace pathways from primary to secondary effects

Integrative approaches:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Use systems biology modeling to predict direct versus indirect effects

  • Apply network analysis to map the propagation of effects through cellular systems

A key insight from existing research is that ndvA mutants retain an active 235,000-dalton protein intermediate involved in β-(1→2)glucan synthesis despite lacking extracellular β-(1→2)glucan . This indicates that NdvA's direct role is in export rather than synthesis, demonstrating how careful analysis can distinguish between direct and indirect effects.

How might structural modifications of NdvA enhance symbiotic efficiency?

Strategic structural modifications of NdvA could potentially enhance symbiotic efficiency through several mechanisms:

Target regions for modification:

  • ATP-binding domains (amino acids 358-616) to alter energy coupling efficiency

  • Membrane-spanning segments identified through hydropathy analysis to modify transport rates

  • Substrate recognition regions to enhance β-(1→2)glucan binding

  • Regulatory domains that control transporter activation

Modification strategies:

  • Site-directed mutagenesis of conserved motifs

  • Domain swapping with more efficient related transporters

  • Addition of stability-enhancing modifications

  • Introduction of conformational locks or switches for activity regulation

Evaluation approaches:

  • Measure export efficiency in vitro using reconstituted systems

  • Assess symbiotic performance through plant growth parameters

  • Quantify nitrogen fixation rates using acetylene reduction assays

  • Compare competitive fitness with wild-type strains in mixed inoculations

Potential outcomes:

  • Increased β-(1→2)glucan export efficiency

  • Improved symbiotic establishment under suboptimal conditions

  • Enhanced nodulation rates or nodule development

  • Greater nitrogen fixation capacity

This research direction could significantly contribute to agricultural sustainability by improving biological nitrogen fixation efficiency in legume crops.

What unresolved questions remain about NdvA's evolutionary relationship to other bacterial exporters?

Several unresolved questions remain regarding NdvA's evolutionary relationship to other bacterial exporters:

Phylogenetic questions:

  • Did NdvA evolve specifically for β-(1→2)glucan export, or was this function acquired later?

  • How did functional divergence occur between NdvA and its homologs in pathogenic bacteria?

  • What selective pressures drove the evolution of substrate specificity?

  • Does the functional equivalence between ndvA and chvA reflect convergent or divergent evolution?

Structural evolution inquiries:

  • Which structural features determine specificity for β-(1→2)glucan versus other substrates?

  • How conserved are the ATP-binding and hydrolysis mechanisms across different exporters?

  • What structural adaptations enable NdvA to function in the symbiotic context?

Methodological approaches:

  • Comprehensive phylogenomic analysis of ABC transporters across bacterial lineages

  • Ancestral sequence reconstruction and functional testing

  • Comparative analysis of selection signatures across different bacterial lifestyles

  • Structural biology studies of NdvA and related transporters

Ecological context:

  • How does NdvA function relate to the ecological niche of Rhizobium as a symbiont?

  • Do environmental factors shape the evolution of these exporters?

  • How does horizontal gene transfer influence the distribution of these exporters?

Addressing these questions will provide insights into the evolution of molecular transport mechanisms and their adaptation to different ecological contexts.

How can NdvA research contribute to sustainable agriculture?

NdvA research has significant potential to contribute to sustainable agriculture through several pathways:

Enhancement of biological nitrogen fixation:

  • Optimizing NdvA function could improve symbiotic efficiency, reducing dependence on chemical fertilizers

  • This addresses a major source of water contamination from nitrogenous fertilizers

  • Modified strains could provide more consistent nitrogen fixation under varying field conditions

Development of improved inoculants:

  • Engineering strains with optimized NdvA activity for better nodulation and nitrogen fixation

  • Creating strains with enhanced stress tolerance through modified β-(1→2)glucan production

  • Developing formulations that maximize symbiotic potential in challenging soils

Applications for marginal environments:

  • Since Rhizobium-legume symbiosis supports crop growth in marginal soils of arid regions , optimized strains could extend agriculture to less productive lands

  • Drought-resistant symbiotic systems could be developed by understanding NdvA function under water limitation

Research approaches:

  • Field trials comparing wild-type and engineered strains across different environments

  • Greenhouse studies measuring plant growth parameters and nitrogen content

  • Economic and environmental impact assessments of reduced fertilizer applications

  • Integration with other sustainable agriculture practices

Practical implementation pathways:

  • Collaboration with agricultural extension services

  • Development of commercial inoculant products

  • Education programs for farmers about biological nitrogen fixation

  • Policy recommendations for incentivizing biological versus chemical nitrogen inputs

By enhancing our understanding of the molecular basis of symbiotic nitrogen fixation, NdvA research contributes directly to more sustainable agricultural systems with reduced environmental impact .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.