Recombinant Rhizobium meliloti Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Membrane Topology and Orientation

R. meliloti CobS is a transmembrane protein with a distinctive membrane topology. Experimental studies have determined that CobS possesses an "N in" orientation, indicating that its N-terminus is located in the cytoplasm . This orientation is crucial for the proper functioning of the protein in the cobalamin biosynthesis pathway.

Various prediction algorithms have attempted to define the transmembrane topology of CobS, with different results regarding the number and arrangement of transmembrane segments. The table below summarizes the predictions from various algorithms compared with experimental findings:

Prediction MethodN-terminal OrientationC-terminal OrientationNumber of TM Segments
TMHMMOutOut4
TOPCONSInOut7
PhobiusInIn6
Experimental ResultInOut-

The discrepancies between prediction algorithms highlight the complexity of membrane protein structure determination and underscore the importance of experimental validation.

Enzymatic Function

CobS functions as a cobalamin synthase in the vitamin B12 biosynthesis pathway. Based on studies of homologous proteins in other bacteria such as Salmonella typhimurium, CobS catalyzes a critical step in the assembly of the nucleotide loop of adenosylcobalamin . Specifically, it joins the lower ligand component (α-ribazole-5′-phosphate) to adenosylcobinamide-GDP to form adenosylcobalamin-5′-phosphate .

Biochemical Mechanism

The nucleotide loop assembly pathway in cobalamin biosynthesis involves several enzymes working in sequence. In this pathway, CobS specifically functions as the cobalamin(-5′-phosphate) synthase enzyme. In vitro studies with the homologous enzyme from S. typhimurium have demonstrated that CobS can use α-ribazole-5′-phosphate as a substrate to form adenosylcobalamin-5′-phosphate . The reaction proceeds as follows:

Adenosylcobinamide-GDP + α-ribazole-5′-phosphate → Adenosylcobalamin-5′-phosphate + GDP

This reaction represents a critical step in the completion of the cobalamin molecule, making CobS essential for vitamin B12 production in these bacteria.

Role in Symbiosis

R. meliloti is a nitrogen-fixing bacterium that forms symbiotic relationships with leguminous plants, particularly alfalfa (Medicago sativa). Research has demonstrated that cobalamin synthesis is essential for successful symbiosis between R. meliloti and its plant hosts . The inability to synthesize cobalamin results in defective symbiotic relationships, highlighting the importance of CobS in this process.

Cobalamin produced with the assistance of CobS serves as a cofactor for three enzymes in R. meliloti:

Cobalamin-Dependent EnzymeFunctionMetabolic Significance
Methionine Synthase (MetH)Catalyzes the final step in methionine biosynthesisEssential for protein synthesis and one-carbon metabolism
Methylmalonyl CoA Mutase (BhbA)Catalyzes a step in the metabolism of branched-chain amino acidsImportant for energy metabolism
Class II Ribonucleotide Reductase (RNR)Catalyzes the synthesis of deoxynucleotides from ribonucleotidesRate-limiting step in DNA synthesis

Metabolic Requirements and Adaptations

Interestingly, R. meliloti relies exclusively on cobalamin-dependent enzymes for certain metabolic functions, despite the existence of cobalamin-independent alternatives in many other organisms . Studies have shown that expression of the cobalamin-independent methionine synthase (MetE) can alleviate symbiotic defects in cobalamin-deficient mutants, indicating that methionine synthesis is a critical requirement during symbiosis .

The reliance on cobalamin-dependent enzymes may provide an evolutionary advantage for R. meliloti in the symbiotic environment. One hypothesis suggests that cobalamin-dependent enzymes are less sensitive to reactive oxygen species (ROS) and reactive nitrogen species (RNS) encountered during symbiosis, providing a metabolic advantage in the plant host environment .

Expression Systems and Production

Recombinant R. meliloti CobS is typically produced in bacterial expression systems, most commonly Escherichia coli. The protein can be expressed with various tags to facilitate purification and characterization, although the specific tag type may vary depending on the experimental requirements . The recombinant protein maintains the enzymatic activity of the native protein, making it valuable for biochemical and structural studies.

Agricultural and Biotechnological Implications

Understanding the function of CobS in R. meliloti has significant implications for agriculture, particularly in enhancing nitrogen fixation in leguminous crops. The essential role of cobalamin in symbiosis makes CobS a potential target for improving plant-microbe interactions in agricultural settings.

Future research directions may include:

  1. Detailed structural characterization of R. meliloti CobS using X-ray crystallography or cryo-electron microscopy

  2. Investigation of the regulation of cobS gene expression during symbiotic interactions

  3. Development of engineered R. meliloti strains with enhanced cobalamin production

  4. Exploration of CobS as a target for improving nitrogen fixation efficiency in leguminous crops

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
cobS; cobV; R01885; SMc04215; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
cobS
Target Protein Sequence
MADIRELWDDVARSVAFLSRIPVPDRYFHGYDGGLGRAVRAFPLAAILITLPAAAIAFIL GALHASSLFSAFLVVAVQAMVTGALHEDGLGDTADGFGGGRDRESALEIMKDSRIGTYGA VALILSFGLRVSALAAFLPLLTPTGGGIALLATAALSRAAMVWHWSRLPPARRGGVAASA GIPEPGATSVALGSGVLLALVLFFLAGIPTVAVWLSFAAFGLAVPGFTRIASRKLGGHTG DTIGATQQLTEVAVLGALALAI
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Rhizobium meliloti* is an enzyme that catalyzes the final two steps in the biosynthesis of cobalamin (vitamin B12). Specifically, CobS joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.