Recombinant Rhizobium meliloti Exopolysaccharide production protein ExoZ (exoZ)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

ExoZ is expressed as a full-length protein (1–317 amino acids) with an N-terminal His tag for purification and detection. Key features include:

PropertyDescription
SourceE. coli (recombinant expression system)
TagN-terminal His tag
Molecular Weight~37.5 kDa (predicted)
Purity>90% (determined by SDS-PAGE)
Gene IDexoZ (UniProt ID: P26502; Synonyms: RB1066, SMb20943)
FunctionPutative role in exopolysaccharide production (exact mechanism undefined)

The amino acid sequence of ExoZ reveals hydrophobic regions and transmembrane domains, suggesting membrane association during biosynthesis .

Production and Expression

ExoZ is produced via recombinant DNA technology in E. coli, with the full-length protein fused to a His tag for affinity chromatography. The expression vector and purification protocols ensure high yield and stability.

Key Production Steps

  1. Cloning: Full-length exoZ gene amplified and ligated into an expression vector (e.g., pET29b).

  2. Expression: Induced in E. coli (e.g., BL21(DE3) strain), monitored by SDS-PAGE.

  3. Purification: His-tagged protein purified via nickel-affinity chromatography.

  4. Quality Control: SDS-PAGE confirms >90% purity; Western blotting validates His-tag presence .

Applications in Research

ExoZ is primarily used in biochemical studies to investigate exopolysaccharide biosynthesis and symbiosis. Applications include:

ApplicationPurpose
SDS-PAGEVerify protein size and purity
Western BlottingDetect ExoZ in R. meliloti lysates or recombinant E. coli cultures
Enzyme Activity AssaysHypothetical use in studying exopolysaccharide polymerization (not reported)

While ExoZ’s exact enzymatic role remains unclear, its recombinant form enables structural and functional studies of EPS-related proteins .

Research Gaps and Future Directions

Current literature lacks functional studies on ExoZ’s role in succinoglycan biosynthesis or symbiosis. Comparative studies with other R. meliloti EPS proteins (e.g., ExoP, ExoM) could elucidate its regulatory or enzymatic contributions. Structural analyses (e.g., X-ray crystallography) may reveal interactions with biosynthetic complexes or substrates .

References

  1. MyBioSource: Recombinant Rhizobium meliloti Exopolysaccharide production protein ExoZ (exoZ), partial [MBS7060816].

  2. Creative Biomart: Recombinant Full-Length Rhizobium meliloti Exopolysaccharide Production Protein ExoZ (Exoz), His-Tagged [RFL29117RF].

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
exoZ; RB1066; SMb20943; Exopolysaccharide production protein ExoZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
exoZ
Target Protein Sequence
MLFHAAEKTGHHFTIGAAGVDVFFVISGFIMWVISDRRSVTPVEFIADRARRIVPVYWLA TGVMVAGALAGLFPNLVLTLEHVLASLFFVPARSPSSGEIWPVLVQGWTLNFEMLFYAVF AGSLFMPRNWRLPVVSGLFLALVIAGRVVAFDDAVMLTYTRPVILEFVAGMIIGEFWLKG RVPPLAVGSALFACSLGGFALIGVLGLPFDELTTGPLAVLLVIGVLSLEANGCVRALSLP GLLGDASYSIYLWHTFAISVVAKAGLAIGLGAPATMFAAVLSGTLIGIAAYMMLERPLLR RGRARRVTAGLAGRAAE
Uniprot No.

Target Background

Function

Essential for the acetyl modification of the third glucose residue within the octasaccharide subunit of succinoglycan (EPS I).

Database Links
Protein Families
Acyltransferase 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of ExoZ in Rhizobium meliloti?

ExoZ functions as an acetyltransferase that is responsible for acetylation during the synthesis of succinoglycan repeat units in Rhizobium meliloti. It acts at the level of repeat unit synthesis in the cytoplasm, before assembly into the complete polysaccharide. While the acetylation modifications performed by ExoZ are not absolutely required for the assembly of the polysaccharide, they play important roles in modifying the properties of the resulting exopolysaccharide .

How does ExoZ fit into the broader exopolysaccharide biosynthesis pathway?

ExoZ is part of the Wzx/Wzy-dependent pathway that synthesizes heteropolysaccharides in Rhizobium meliloti. In this pathway, repeat units are synthesized on a C55-undecaprenol phosphate (und-P) lipid carrier in the inner leaflet of the cytoplasmic membrane through sequential activity of various glycosyltransferases (including ExoY, ExoA, ExoL, ExoM, ExoO, and ExoU). ExoZ then functions as an acetyltransferase that adds non-sugar decorations to the repeat unit, while ExoH adds succinyl groups . These decorated repeat units are then translocated across the membrane by Wzx flippase (ExoT/ExoQ) and polymerized by Wzy (ExoP) before being exported through the outer membrane.

What are the proven methods for expressing recombinant ExoZ protein?

Recombinant ExoZ can be expressed using standard molecular cloning techniques in appropriate expression systems. Based on similar work with related proteins like ExoM, the following methodology is recommended:

  • Clone the exoZ gene into an expression vector with an appropriate promoter and affinity tag (typically His-tag)

  • Transform the construct into a suitable expression host (E. coli BL21(DE3) or similar strains)

  • Induce protein expression with IPTG (typically 0.1-1.0 mM) when cultures reach mid-log phase

  • Harvest cells after 3-6 hours of induction (or overnight at lower temperatures)

  • Lyse cells and purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Further purify using size exclusion chromatography if needed

For improved solubility, expression at lower temperatures (16-20°C) and the use of solubility-enhancing fusion partners may be beneficial.

How can researchers reliably measure ExoZ enzymatic activity in vitro?

ExoZ activity can be measured by monitoring the transfer of acetyl groups to the appropriate glycolipid substrate. Based on approaches used for similar enzymes like ExoM, a recommended assay format includes:

  • Prepare reaction mixtures containing purified ExoZ, acceptor substrate (appropriate oligosaccharide intermediates from the succinoglycan pathway), and acetyl-CoA as the donor

  • Include appropriate buffers (typically 50 mM HEPES or Tris, pH 7.5) and cofactors (typically Mg²⁺)

  • Incubate at optimal temperature (usually 25-37°C) for a defined time period

  • Analyze reaction products by:

    • HPLC or LC-MS to detect modified oligosaccharides

    • Radiochemical assays using [¹⁴C]-labeled acetyl-CoA

    • Colorimetric assays that detect CoA release

For reliable results, include appropriate positive and negative controls, and validate substrate specificity by testing with structurally related compounds.

How do mutations in exoZ affect the symbiotic capabilities of Rhizobium meliloti?

Mutations in exoZ alter the acetylation pattern of succinoglycan, which can impact the symbiotic process in several ways:

  • Infection Thread Formation: Exopolysaccharides with altered acetylation may affect the formation and progression of infection threads in root hairs

  • Host Immune Response: Modified succinoglycan structures may trigger different levels of host defense responses

  • Biofilm Properties: Changes in acetylation affect the physical properties of biofilms, including viscosity and adhesion capabilities

While ExoZ-mediated acetylation is not absolutely required for polysaccharide assembly, unlike pyruvylation by ExoV which appears essential , it significantly influences the biological properties of the exopolysaccharide and consequently the symbiotic relationship.

What is the relationship between ExoZ and other regulatory systems in Rhizobium meliloti?

ExoZ activity and expression may be influenced by broader regulatory networks in Rhizobium meliloti:

  • ExoR-ExoS/ChvI System: The ExoR protein acts as a negative regulator of succinoglycan synthesis by binding to ExoS in the periplasm to inhibit ExoS/ChvI signaling . This regulatory system likely influences ExoZ activity indirectly through transcriptional control.

  • Nutrient Sensing Pathways: Expression of exopolysaccharide biosynthesis genes, including exoZ, responds to environmental signals and nutrient availability.

  • Quorum Sensing Systems: Population density signals may coordinate the production of exopolysaccharides through modulation of the expression of biosynthetic genes.

Understanding these regulatory connections is critical for developing strategies to manipulate ExoZ activity for research purposes.

How can ExoZ be leveraged for bioengineering novel exopolysaccharides?

ExoZ can be utilized in combinatorial biosynthetic approaches to create novel exopolysaccharides with specific properties:

  • Pathway Engineering: ExoZ can be combined with glycosyltransferases from different bacterial species to create hybrid exopolysaccharide structures with novel acetylation patterns.

  • Substrate Specificity Manipulation: Protein engineering of ExoZ through directed evolution or rational design could alter its acceptor specificity, enabling acetylation of different oligosaccharide structures.

  • Controlled Expression Systems: Developing tunable expression systems for ExoZ allows control over the degree of acetylation, potentially leading to exopolysaccharides with tailored physical properties .

The major challenge in such combinatorial approaches is overcoming substrate specificities, as components from different pathways may not recognize heterologous substrates efficiently .

What methodologies are most effective for studying ExoZ protein-protein interactions?

To investigate how ExoZ interacts with other proteins in the exopolysaccharide biosynthesis machinery, several complementary approaches are recommended:

  • Co-immunoprecipitation: Similar to techniques used to study ExoR-ExoS interactions , anti-ExoZ antibodies can be used to pull down potential interaction partners from cell lysates.

  • Bacterial Two-Hybrid Systems: These genetic approaches can screen for potential protein interactions in vivo.

  • Surface Plasmon Resonance: This technique provides quantitative information about binding kinetics between purified ExoZ and potential partners.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify proteins in close proximity to ExoZ in the native environment.

  • Fluorescence Microscopy: Fluorescently tagged ExoZ can be used to visualize its localization and potential co-localization with other components of the biosynthetic machinery.

What are common issues in purifying active recombinant ExoZ and how can they be addressed?

Researchers often encounter several challenges when working with recombinant ExoZ:

ChallengePotential Solutions
Poor solubility- Express at lower temperatures (16-20°C)
- Use solubility-enhancing tags (SUMO, MBP)
- Optimize buffer conditions (add glycerol, adjust salt concentration)
Low yield- Optimize codon usage for expression host
- Try different expression hosts
- Adjust induction conditions (IPTG concentration, timing)
Reduced activity- Ensure proper folding with chaperone co-expression
- Include appropriate cofactors in purification buffers
- Minimize time between purification and activity assays
Protein instability- Add protease inhibitors during purification
- Store with glycerol at -80°C
- Consider flash-freezing aliquots in liquid nitrogen

How can researchers differentiate the effects of ExoZ from other exopolysaccharide modification enzymes?

Distinguishing the specific contributions of ExoZ from other modification enzymes requires careful experimental design:

  • Generate Specific Mutants: Create precise gene knockouts or point mutations in exoZ while leaving other modification genes intact.

  • Structural Analysis: Use detailed analytical techniques (NMR, mass spectrometry) to characterize the fine structure of exopolysaccharides produced by wild-type and mutant strains.

  • Complementation Studies: Reintroduce exoZ under controlled expression to confirm phenotypic changes are specifically due to ExoZ activity.

  • In vitro Reconstitution: Develop cell-free systems with purified components to test the specific activity of ExoZ in isolation from other cellular processes.

  • Comparative Studies: Compare the effects of mutations in different modification genes (exoZ, exoH, exoV) to understand their distinct contributions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.