Recombinant Rhizobium meliloti Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Flagellar Assembly

FlhB operates in a two-step regulatory mechanism:

  1. Hook elongation: The growing hook structure signals via FliK to FlhB’s cytoplasmic domain.

  2. Substrate specificity switch: Conformational changes in FlhB redirect the export apparatus from hook-type substrates (e.g., Flg proteins) to filament-type substrates (e.g., flagellins) .

    • Mutations in FlhB (e.g., A300T, G295E) bypass the need for FliK, enabling filament assembly on polyhooks .

Genetic Suppressor Mutations in FlhB

Extragenic suppressor mutations in flhB restore motility in fliK polyhook mutants by enabling filament assembly. Identified mutations include:

Mutation in FlhBEffect on Filament AssemblyCitation
A300T/VPartial restoration of filament polymerization
G295EAltered interaction with FliK
S323PStabilizes substrate-switching conformation
L345PDisrupts FliK binding

Experimental Models

  • Strains:

    • S. meliloti RU11/212 (ΔfliK) produces polyhooks but no filaments .

    • Suppressor strains (e.g., RU13/202) with flhB mutations exhibit polyhook-filament (phf) structures .

  • Protein secretion:

    • FlhB is essential for exporting flagellins (FlaA-FlaD) in S. meliloti .

    • In ΔfliK mutants, flagellin secretion is blocked unless suppressor mutations in flhB occur .

Interaction with FliK

  • Mechanism: FliK measures hook length and activates FlhB via its C-terminal domain .

  • Species specificity:

    • S. meliloti FliK cannot complement Salmonella or E. coli fliK mutants due to structural divergence .

    • The S. meliloti FlhB-FliK system is adapted for complex filaments composed of heterodimeric flagellins .

Experimental Tools and Strains

Recombinant FlhB studies utilize:

Plasmid/StrainPurposeCitation
pRU2930 (pQE60)Cloning and expression of fliK
S. meliloti RU11/001Wild-type control
E. coli HCB7Testing cross-species FliK secretion

Implications for Flagellar Research

  • Evolutionary insight: FlhB’s role in S. meliloti highlights divergence from enterobacterial models, particularly in managing multi-subunit filaments .

  • Biotechnological applications: Engineering FlhB mutations could optimize bacterial motility in agricultural inoculants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
flhB; R00650; SMc03018; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
flhB
Target Protein Sequence
MAEEQDKDSKTEAPSEKKISDATEKGNVPFSREVTAFASTLAIYIFVVFFLSDGAANMAE ALKDIFEQPEAWRLDTATDAVALISHVVLKCAALVLPVFILLILFGVGSSIFQNLPRPVL DRIQPKWNRVSPAAGFKRIYGVQGLVEFGKSLFKIIVVSIVVVLVLWNDYFATLDMMFSD PVTIFTTMISDLKQIIIVVLFATATLAIVDLFWTRHHWYTELRMTRQEVKDELKQSQGDP IVKSRLRSMQRDRARKRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVA LKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELIHRVYAAQPQQRRVT
Uniprot No.

Target Background

Function
This protein is essential for the formation of the rod structure in the basal body of the flagellar apparatus. In conjunction with FliI and FliH, it may constitute the export apparatus for flagellin.
Database Links
Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is FlhB and what is its role in flagellar biosynthesis?

FlhB is a highly conserved membrane protein that functions as an essential component of the flagellar export apparatus. It serves as an export switch factor responsible for transporting intracellular proteins to the extracellular environment, including structural components needed for flagellar assembly . In bacterial species such as Listeria monocytogenes, FlhB deletion results in complete abolishment of flagellar synthesis and motility, indicating its critical role in the flagellar assembly process . The protein mediates the transport of flagellar components through the flagellar type III secretion system, which is structurally and functionally related to pathogen-associated T3SS machinery .

How does FlhB interact with other flagellar proteins in R. meliloti?

FlhB works in concert with other flagellar basal body structural proteins such as FliM and FliY to enable proper flagellar assembly . These proteins form part of a complex regulatory and structural network. While FliM and FliY are components of the C-ring (a key structure in the flagellar basal body), FlhB functions in the export apparatus. Together, these proteins enable the coordinated export and assembly of flagellar components . In R. meliloti, as in other bacterial species, the flagellar biosynthesis proteins participate in a hierarchical assembly process where the expression and function of FlhB is essential for the transport and incorporation of flagellins like FlaA and FlaB, which are the main structural components of the flagellar filament .

What phenotypic changes occur in R. meliloti when flhB is mutated?

Mutations in the flhB gene result in significant phenotypic changes, primarily the complete loss of motility due to the absence of flagellar filaments . Based on studies in related bacterial systems, deletion of flhB leads to:

  • Complete abolishment of flagellar filament formation

  • Total loss of bacterial motility on semi-solid media

  • Downregulation of transcription in multiple flagellar-related genes

  • Altered expression patterns of other flagellar proteins

  • Disruption of the secretion of structural flagellar components

These phenotypic changes underscore the essential role of FlhB in flagellar biosynthesis and bacterial motility.

What are the most effective methods for creating recombinant FlhB in R. meliloti?

Creating recombinant FlhB in R. meliloti typically involves several molecular biology approaches:

Gene Cloning and Expression Strategy:

  • PCR amplification of the flhB gene from R. meliloti genomic DNA using specific primers with appropriate restriction sites

  • Cloning into an expression vector compatible with Rhizobium, such as pRK290 (used successfully for flagellin gene studies)

  • Transformation into R. meliloti using electroporation or conjugation methods

Complementation Approach:
One effective strategy is to first create a flhB deletion mutant using homologous recombination (similar to methods used for flaA and flaB genes) , then complement this strain with the wild-type or modified flhB gene. This approach allows for functional characterization through complementation studies .

Expression Control:
For controlled expression, the native promoter or an inducible promoter system can be used. When using multiple copies of flagellar genes, care must be taken as overexpression may disrupt regulatory networks, as observed with flagellin genes in R. meliloti .

How can researchers verify the expression and localization of recombinant FlhB?

Verification of recombinant FlhB expression and localization involves multiple complementary techniques:

Western Blot Analysis:

  • Prepare bacterial cultures to stationary phase

  • Isolate total cell proteins using SDS-PAGE sample buffer

  • Separate proteins using 12% SDS-PAGE

  • Immunoblot with anti-FlhB antisera

  • Use GAPDH as an internal control for normalization

Membrane Protein Fractionation:
Since FlhB is a membrane protein, subcellular fractionation is essential:

  • Pellet bacteria by centrifugation (13,000 × g, 20 min, 4°C)

  • Separate membrane fractions using ultracentrifugation

  • Analyze protein localization through western blotting of different cellular fractions

Immunofluorescence Microscopy:
To visualize the localization of FlhB at the flagellar basal body, immunofluorescence using specific antibodies against FlhB can provide spatial information about its integration into the flagellar apparatus.

What are the key considerations for designing mutation studies of FlhB in R. meliloti?

When designing mutation studies of FlhB in R. meliloti, researchers should consider:

Strategic Mutation Design:

  • Target conserved domains within FlhB that are predicted to be functionally important

  • Consider creating point mutations rather than complete deletions to study specific protein functions

  • Include C-terminal domain mutations, as this region is critical for substrate specificity switching

Complementation Controls:
Always include complementation controls to verify that phenotypes are specifically due to FlhB mutations and not polar effects on other genes. This requires reintroducing the wild-type flhB gene on a plasmid vector .

Phenotypic Assays:
Employ multiple phenotypic assays to comprehensively evaluate mutant effects:

  • Motility assays on semi-solid media

  • Electron microscopy to visualize flagellar structures

  • Protein expression analysis for flagellar components

  • Transcriptional studies of flagellar genes

Interaction Studies:
Design experiments to examine how mutations affect interactions with other flagellar proteins, as FlhB functions as part of a complex protein network .

How does FlhB regulate substrate specificity during flagellar assembly in R. meliloti?

FlhB plays a critical role in controlling substrate specificity during flagellar assembly through a sophisticated molecular mechanism:

Autocleavage and Conformational Changes:
FlhB undergoes autocleavage that is essential for its function as a substrate specificity switch. This process involves:

  • Self-cleavage between the N-terminal transmembrane domain and the C-terminal cytoplasmic domain

  • Conformational changes that alter the binding properties of FlhB

  • Sequential recognition of early versus late flagellar substrates

Hierarchical Export Control:
FlhB mediates the ordered export of flagellar proteins by:

  • Initially facilitating export of rod and hook proteins

  • Switching specificity after hook completion to allow filament protein export

  • Coordinating with other proteins like FliK that measure hook length

Protein-Protein Interactions:
The regulatory function of FlhB depends on specific interactions with:

  • Other export apparatus components

  • Chaperones that deliver flagellar proteins

  • Substrate proteins themselves, including flagellins

Studies in related bacterial systems suggest that mutations affecting the C-terminal domain of FlhB can disrupt this regulatory mechanism, leading to aberrant flagellar structures or complete absence of flagella.

What is the relationship between FlhB and the flagellar filament composition in R. meliloti?

R. meliloti possesses complex flagellar filaments composed of multiple flagellin subunits, and FlhB plays a crucial role in regulating their assembly:

Multiple Flagellin Regulation:
R. meliloti flagellar filaments contain multiple flagellins encoded by separate genes (flaA and flaB) . Deletion studies in related species suggest that FlhB controls the export of these flagellins and influences their organization within the filament .

Spatial Organization:
The complex flagellar filament of R. meliloti exhibits a defined spatial organization:

  • The proximal portion (near the cell) is assembled from FlaB subunits

  • The distal portion (tip) is made from FlaA subunits

  • FlhB likely mediates this ordered assembly through regulated export

Expression and Export Control:
FlhB influences not only the export but also the expression of flagellins through regulatory feedback mechanisms:

  • Flagellin transcript levels are downregulated when FlhB is deleted

  • FlhB-dependent export may be coupled to flagellin production

  • The export state of the flagellar apparatus provides feedback to gene expression systems

How do post-translational modifications affect FlhB function in the flagellar export system?

Post-translational modifications significantly impact FlhB function in the flagellar export system:

Autocleavage:
The most critical post-translational modification of FlhB is autocleavage, which:

  • Occurs between conserved asparagine and proline residues

  • Creates N-terminal and C-terminal domains that remain associated

  • Is essential for the substrate specificity switch during flagellar assembly

Conformational Dynamics:
After cleavage, FlhB undergoes conformational changes that:

  • Alter binding interfaces for flagellar substrates

  • Enable interaction with different chaperones

  • Facilitate recognition of late flagellar substrates like flagellins

Potential Phosphorylation:
Though not extensively characterized in R. meliloti, research in related systems suggests that:

  • Phosphorylation may fine-tune FlhB function

  • Regulatory kinases might target FlhB as part of flagellar expression control

  • The phosphorylation state could influence interaction with other flagellar proteins

What transcriptional analysis methods are most suitable for studying flhB regulation in R. meliloti?

Several transcriptional analysis methods are particularly valuable for studying flhB regulation:

Quantitative RT-PCR (qRT-PCR):
This method allows precise quantification of flhB transcript levels under various conditions:

  • Extract total RNA from R. meliloti cultures

  • Synthesize cDNA using reverse transcriptase

  • Perform qPCR with specific primers for flhB and reference genes

  • Analyze using the 2^-ΔΔCt method for relative quantification

Transcriptional Fusions:
Reporter gene fusions provide insights into flhB promoter activity:

  • Fuse the flhB promoter region to a reporter gene like lacZ

  • Integrate the construct into the R. meliloti genome or maintain on a plasmid

  • Measure β-galactosidase activity under different conditions

  • Interpret results to understand transcriptional regulation

RNA-Seq Analysis:
For genome-wide transcriptional effects:

  • Prepare RNA from wild-type and flhB mutant strains

  • Perform RNA-seq to identify differentially expressed genes

  • Focus analysis on flagellar and motility genes

  • Use bioinformatics to identify regulatory networks connected to FlhB function

Table 1: Comparison of Transcriptional Analysis Methods for flhB Research

MethodAdvantagesLimitationsKey Applications
qRT-PCRHigh sensitivity, quantitative, targetedLimited to known genes, requires reference genesPrecise measurement of flhB expression levels
Transcriptional FusionsIn vivo promoter activity, temporal studiesIndirect measurement, potential context effectsRegulatory studies, promoter analysis
RNA-SeqGenome-wide, unbiased, discovers novel transcriptsHigher cost, complex data analysisGlobal regulatory networks, identifying FlhB-dependent genes
Northern BlotTranscript size information, direct visualizationLower sensitivityConfirmation of transcript structure and processing

What protein-protein interaction methods are effective for studying FlhB interactions in the flagellar export apparatus?

Several protein-protein interaction methods are particularly valuable for studying FlhB associations:

Bacterial Two-Hybrid Assays:
This system allows detection of interactions in a bacterial context:

  • Fuse FlhB and potential interacting partners to complementary fragments of a reporter protein

  • Co-express in a bacterial reporter strain

  • Measure reporter activity to detect interactions

  • Validate with controls and mutation analysis

Co-Immunoprecipitation (Co-IP):
For direct detection of protein complexes:

  • Create epitope-tagged versions of FlhB

  • Express in R. meliloti cells

  • Lyse cells under gentle conditions to preserve complexes

  • Immunoprecipitate with antibodies against the tag

  • Identify co-precipitating proteins by western blot or mass spectrometry

Cross-linking Studies:
To capture transient or weak interactions:

  • Treat intact cells with membrane-permeable cross-linkers

  • Isolate membrane fractions containing FlhB

  • Identify cross-linked complexes using antibodies or mass spectrometry

  • Analyze complexes to identify interacting partners

Surface Plasmon Resonance (SPR):
For kinetic analysis of purified components:

  • Purify recombinant FlhB and potential binding partners

  • Immobilize one protein on an SPR chip

  • Measure binding kinetics of interactions

  • Determine affinity constants for different FlhB interactions

What are the most reliable methods for visualizing flagellar structures in R. meliloti flhB mutants?

Visualization of flagellar structures in R. meliloti requires specialized techniques:

Transmission Electron Microscopy (TEM):
The gold standard for detailed flagellar visualization:

  • Negatively stain bacterial cells with uranyl acetate or phosphotungstic acid

  • Examine samples under TEM at magnifications of 10,000-50,000×

  • Compare wild-type and flhB mutant strains for flagellar presence, number, and structure

  • Analyze flagellar filament thickness and structural integrity

Cryo-Electron Microscopy:
For high-resolution structural analysis:

  • Prepare R. meliloti samples by rapid freezing in vitreous ice

  • Examine under cryo-EM conditions

  • Potentially obtain 3D reconstructions of flagellar structures

  • Compare wild-type and mutant structures at near-atomic resolution

Immunofluorescence Microscopy:
For specific labeling of flagellar components:

  • Fix R. meliloti cells gently to preserve flagellar structures

  • Label with anti-flagellin antibodies followed by fluorescent secondary antibodies

  • Visualize using confocal or super-resolution microscopy

  • Quantify flagellar number and distribution

Motility Assays as Functional Visualization:
Complement microscopy with functional assays:

  • Inoculate semi-solid media (0.3% agar) with wild-type and mutant strains

  • Incubate at appropriate temperature (typically 28-30°C for R. meliloti)

  • Measure swimming diameter over time

  • Correlate motility with microscopic observations

How can understanding FlhB function contribute to symbiotic interaction studies of R. meliloti?

Understanding FlhB function can provide valuable insights into the symbiotic relationship between R. meliloti and legume plants:

Motility and Root Colonization:
Flagellar motility mediated by FlhB-dependent processes influences:

  • Movement of R. meliloti toward plant roots

  • Initial colonization of the rhizosphere

  • Positioning near root hair emergence sites

  • Competitive ability against other soil microorganisms

Flagellar Regulation During Symbiosis:
The regulation of FlhB and flagellar biosynthesis changes during symbiotic development:

  • Flagellar genes are typically downregulated during nodule invasion

  • FlhB-dependent export systems may be repurposed for secretion of symbiosis-related proteins

  • Understanding this transition may reveal regulatory connections between motility and symbiosis

Resource Allocation:
FlhB-dependent flagellar biosynthesis represents a significant energy investment:

  • R. meliloti strains engineered for altered resource allocation (e.g., biotin overproduction) show changes in growth dynamics that might affect flagellar synthesis

  • Understanding how FlhB function integrates with metabolic networks could reveal how bacteria balance motility with other cellular processes during symbiosis

Table 2: Potential Roles of FlhB in Different Stages of R. meliloti-Legume Symbiosis

Symbiotic StagePotential FlhB-Related FunctionsResearch Implications
Pre-infectionFlagellar assembly for chemotaxis toward root exudatesTargeting FlhB to study motility contribution to host location
Root attachmentTransition from motile to attached stateInvestigating FlhB regulation during lifestyle switch
Infection thread formationPossible repurposing of export machineryExamining dual roles of T3SS components in motility and symbiosis
Bacteroid differentiationDownregulation of flagellar synthesisStudying regulatory connections between FlhB and symbiotic genes

What insights does comparative analysis of FlhB across bacterial species provide for R. meliloti research?

Comparative analysis of FlhB across different bacterial species yields valuable insights for R. meliloti research:

Structural Conservation and Variation:
FlhB proteins show varying degrees of conservation:

  • The transmembrane domains and cleavage sites are highly conserved

  • C-terminal domains show greater variation related to substrate specificity

  • R. meliloti-specific features may relate to the complex flagellar structure with multiple flagellins

Functional Parallels with Pathogenic Bacteria:
Studies in L. monocytogenes and other pathogens reveal:

  • FlhB functions in flagellar T3SS that parallels pathogen-associated T3SS

  • In L. monocytogenes, FlhB affects expression of FlaA, FliM, and FliY proteins

  • Similar regulatory networks might exist in R. meliloti despite its non-pathogenic nature

Evolutionary Adaptations:
Differences in FlhB structure and function reflect ecological adaptations:

  • In soil bacteria like R. meliloti, FlhB may be adapted for complex environmental responses

  • The relationship between complex flagellar structures in Rhizobium species and their FlhB proteins suggests co-evolution of these components

Cross-Species Experimental Approaches:
Knowledge from model organisms informs R. meliloti research:

  • Methodologies successful in E. coli or Salmonella can be adapted for R. meliloti

  • Heterologous expression of R. meliloti FlhB in other bacteria can reveal species-specific functionality

  • Chimeric FlhB proteins combining domains from different species can identify functional regions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.