Recombinant Rhizobium meliloti Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

fliP is a hydrophobic protein (245 amino acids) encoded by the fliP gene in S. meliloti. It is part of the flagellar biosynthetic regulon and plays a role in flagellar assembly and secretion.

PropertyDetail
Source OrganismSinorhizobium meliloti (strain 1021)
Uniprot IDP37827
Molecular Weight~27 kDa (estimated from sequence)
Sequence FeaturesSignal peptide (N-terminal, 21 residues), hydrophobic regions
Recombinant FormProduced via bacterial expression systems; purified for research

Hydrophobic Profile:

  • Predominantly hydrophobic domains suggest a role in membrane or secretion channel interactions .

Research Findings and Biological Roles

Critical Studies on fliP:

  1. Motility and Flagellation:

    • Deletion of fliP results in non-motile strains lacking flagella .

    • Flagellar assembly defects correlate with impaired swarming motility in S. meliloti .

  2. Symbiotic Interactions:

    • fliP mutants form normal nitrogen-fixing nodules on alfalfa, indicating no direct role in symbiosis .

    • Flagella are not essential for root colonization but may influence rhizosphere competence .

  3. Evolutionary Conservation:

    • Homology: Shares sequence similarity with secretion proteins in pathogens (e.g., Xanthomonas, Shigella) .

    • Hypothesis: Potential role in exporting virulence factors or flagellar components .

Applications in Biotechnology

Recombinant fliP is utilized in:

ApplicationDetails
Flagellar ResearchStudying flagellar assembly mechanisms and secretion pathways
Symbiosis EngineeringInvestigating motility-symbiosis trade-offs in legume-rhizobia interactions
Genetic Engineering ToolsTargeted deletions for functional analysis using Flp/FRT or Cre/loxP systems

Example Workflow:

  1. Recombinant Production:

    • Expressed in E. coli using T7 promoter systems .

    • Purified via chromatography for in vitro studies .

  2. Functional Assays:

    • Complementation of fliP mutants to restore motility .

    • Interaction studies with flagellar proteins (e.g., FlgH, FliL) .

Data Tables

Table 1: Key Research Findings

StudyObservationReference
fliP deletion mutantsNon-motile, aflagellate; normal symbiosis with alfalfa
Homology to secretion proteinsSimilarity to Xanthomonas pathogenicity proteins
Flagellar regulon hierarchyfliP regulated by visN/ visR; class II gene in flagellar assembly

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fliP; R00668; SMc03036; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
fliP
Target Protein Sequence
MLRFATFIIAMMAMSGIAGAQSFPADILNTPVDGSVASWIIRTFGLLTVLSVAPGILIMV TSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAPTFDRAWRDGIDPLLKNEI SETDAMQRMSEPFREFMVANTRDKDLQLFIDIAREKGQTVVVDEKVDLRAVVPAFMISEI RRGFEIGFLIMLPFLVIDLIVATITMAMGMMMLPPTAISLPFKILFFVLIDGWNLLVGSL VRSFI
Uniprot No.

Target Background

Function
This protein plays a crucial role in the flagellum-specific transport system.
Database Links
Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is Rhizobium meliloti and what makes its flagellar system significant?

Rhizobium meliloti (also known as Sinorhizobium meliloti) is a soil-dwelling bacterium that forms nitrogen-fixing symbiotic relationships with leguminous plants, particularly alfalfa (Medicago sativa). The bacterium possesses 5-10 peritrichously inserted complex flagella that form right-handed flagellar bundles, allowing it to swim at speeds up to 60 μm/s through a pattern of straight runs and quick directional changes without the vigorous angular motion (tumbling) observed in Escherichia coli . This distinctive motility system plays a crucial role in the bacterium's ability to colonize plant roots and establish symbiotic relationships, making it an important model system for studying bacterial motility and plant-microbe interactions .

How does the fliP gene contribute to flagellar structure and function in R. meliloti?

The fliP gene encodes a flagellar biosynthetic protein that is essential for flagellar assembly in R. meliloti. Strains carrying insertions within this gene are non-motile and lack flagella entirely, demonstrating fliP's critical role in flagellar biogenesis . The FliP protein is likely involved in the secretion of specific flagellar proteins from bacterial cells, serving as a component of the flagellar export apparatus. This export machinery is responsible for translocating flagellar proteins from the cytoplasm to their assembly sites, which is necessary for the proper construction of the complex flagellar structure . Without functional FliP, the flagellar export system fails, preventing flagellum formation and resulting in non-motile bacteria.

What are the evolutionary relationships between fliP and similar genes in other bacteria?

The FliP protein shows significant similarity to several bacterial gene products involved in pathogenicity in both plant and animal pathogens . This evolutionary conservation suggests that fliP and its homologs in other bacteria share a common ancestral origin and functional role in protein secretion mechanisms. Many bacterial pathogens utilize secretion systems that share structural and functional similarities with the flagellar export apparatus, indicating possible evolutionary links between flagellar assembly and virulence mechanisms. The conservation of fliP across diverse bacterial species makes it a valuable target for studying the evolution of bacterial secretion systems and their roles in both motility and pathogenicity .

What is the molecular structure of the FliP protein and how does it function in the flagellar assembly?

The FliP protein is an integral membrane component of the flagellar type III secretion system. Although the complete three-dimensional structure of R. meliloti FliP has not been fully characterized in the provided search results, research on homologous proteins suggests that FliP contains multiple transmembrane domains that anchor it within the inner membrane of the bacterial cell. These transmembrane segments likely form part of a channel or pore structure through which flagellar proteins are exported . FliP functions as part of a multiprotein export apparatus that recognizes flagellar proteins in the cytoplasm and facilitates their translocation across the cell membrane for incorporation into the growing flagellar structure. The functional activity of FliP depends on its correct integration into this export complex, where it coordinates with other flagellar proteins to ensure proper protein secretion during flagellum assembly .

How is the expression of fliP regulated in R. meliloti?

While the provided search results don't specifically detail the regulatory mechanisms controlling fliP expression in R. meliloti, the regulation of flagellar genes typically follows a hierarchical pattern in bacteria. Based on knowledge of similar systems, fliP expression is likely controlled as part of a flagellar regulon, where master regulatory proteins respond to environmental cues to coordinate the sequential expression of flagellar genes. In R. meliloti, flagellar formation and motility are known to be influenced by environmental factors such as nutrient availability and population density, suggesting that fliP expression may be integrated into broader regulatory networks that govern bacterial behavior in response to changing conditions . Further research specifically examining the transcriptional and post-transcriptional control of fliP in R. meliloti would be valuable for understanding how flagellar biosynthesis is coordinated with other cellular processes.

How does disruption of fliP affect bacterial swimming behavior and chemotaxis?

Disruption of the fliP gene in R. meliloti results in non-motile bacteria that completely lack flagella . This abolishes swimming ability, eliminating the characteristic motility pattern of straight runs and directional changes observed in wild-type cells. The absence of flagella prevents the bacteria from responding to chemotactic stimuli, as the mechanisms of chemotaxis depend on functional flagellar rotation. In wild-type R. meliloti, chemotactic responses involve extending straight runs when moving toward attractants, which corresponds to prolonged intervals of clockwise flagellar rotation . Without fliP and consequently without flagella, mutant bacteria cannot execute this behavior, rendering them incapable of directional movement in response to chemical gradients. This severely impairs their ability to locate and colonize favorable microenvironments, including plant roots .

What is the relationship between fliP function and biofilm formation in R. meliloti?

Studies on flagella-less S. meliloti mutants (which would include fliP mutants) have demonstrated that these strains exhibit reduced biofilming capabilities . This indicates that functional flagella, dependent on proper fliP expression, play a significant role in biofilm development. The connection between flagella and biofilm formation is multifaceted: flagella provide motility that allows bacteria to reach surfaces suitable for colonization; they can serve as adhesins for initial attachment to surfaces; and they may contribute to the structural architecture of developing biofilms . The reduced biofilm formation in flagella-less mutants suggests that fliP-dependent flagellar assembly is important not only for swimming motility but also for establishing structured bacterial communities on surfaces, which represents a significant aspect of R. meliloti's lifestyle in soil and rhizosphere environments .

How do the mechanics of flagellar rotation in R. meliloti differ from other well-studied bacteria?

R. meliloti exhibits a unique pattern of flagellar rotation that distinguishes it from well-studied models like E. coli and Salmonella. While E. coli alternates between clockwise and counterclockwise flagellar rotation to produce runs and tumbles, R. meliloti flagella rotate exclusively in the clockwise direction . Directional changes in swimming R. meliloti occur during very brief stops in flagellar rotation (shorter than 0.1 s), which typically happen every 1-2 seconds, rather than through reversals in rotation direction . This distinctive rotational mechanism produces a swimming pattern consisting of straight runs interrupted by quick directional changes without the vigorous tumbling seen in E. coli. The unique mechanics of R. meliloti flagellar rotation suggest that fliP and other flagellar proteins may have evolved species-specific structural or functional adaptations to support this distinctive motility pattern .

What molecular similarities exist between flagellar protein secretion and nodulation factor secretion?

The FliP protein shows significant similarity to several bacterial gene products involved in pathogenicity in both plant and animal pathogens, suggesting a common functional role in protein secretion mechanisms . This evolutionary relationship between flagellar export and other bacterial secretion systems extends to mechanisms involved in symbiotic interactions. The secretion of nodulation factors and other symbiosis-related proteins by R. meliloti uses specialized secretion systems that share some structural and functional similarities with the flagellar export apparatus. Both systems must transport specific proteins across the bacterial membrane to interact with the external environment or host organisms. The mechanistic parallels between these secretion systems may explain why disruption of fliP, while abolishing flagellar assembly, doesn't prevent nodulation factor secretion and subsequent symbiotic interactions .

Table 1: Comparative Analysis of Methods for Creating fliP Mutants

MethodAdvantagesLimitationsApplication in fliP Research
Tn5 MutagenesisRandom insertion, high efficiencyNon-targeted, requires screeningSuccessfully used to generate fliP insertion mutants
Site-directed mutagenesisPrecise modifications at specific sitesRequires prior sequence knowledgeUseful for analyzing specific functional domains of FliP
CRISPR-Cas9Highly specific, efficient editingRequires optimization for R. melilotiEmerging approach for precise gene editing
Conjugation from E. coliEstablished protocol for R. melilotiRequires selection markersUsed for introducing recombinant constructs

For generating recombinant fliP mutants in R. meliloti, transposon mutagenesis using Tn5 has been successfully employed . This approach involves introducing the transposon into R. meliloti cells, allowing random insertion into the genome, and then screening for non-motile phenotypes. Confirmation of fliP disruption requires molecular techniques such as PCR amplification of the insertion site, followed by sequencing to verify that the transposon has disrupted the fliP gene. Southern blotting can confirm single transposon insertions, while complementation assays using plasmids carrying a wild-type copy of fliP can verify that the motility defect is specifically due to fliP disruption. Modern approaches might include more targeted methods such as CRISPR-Cas9-based gene editing, which would allow precise modifications to the fliP gene without introducing additional genetic elements .

How can researchers effectively analyze the protein secretion function of FliP?

The analysis of FliP's protein secretion function requires a combination of genetic, biochemical, and microscopic approaches:

  • Secretion assays: Researchers can use reporter proteins that are normally secreted through the flagellar export apparatus. By comparing secretion levels between wild-type and fliP mutant strains, the contribution of FliP to export efficiency can be quantified.

  • Protein localization studies: Immunofluorescence microscopy or fluorescent protein fusions can be used to track the localization of flagellar proteins in wild-type versus fliP mutant backgrounds, revealing which step in flagellar assembly is blocked.

  • Protein interaction studies: Co-immunoprecipitation, bacterial two-hybrid assays, or pull-down experiments can identify FliP's interaction partners within the flagellar export apparatus, providing insights into its functional role.

  • Membrane fraction analysis: Since FliP is a membrane protein, analyzing membrane fractions from wild-type and mutant bacteria can reveal changes in membrane protein composition and organization that result from fliP disruption.

  • Cross-species complementation: Testing whether fliP genes from other bacterial species can complement R. meliloti fliP mutants provides insights into conserved functional domains and species-specific adaptations .

What advanced imaging techniques are most informative for studying flagellar structure and function in R. meliloti?

Advanced imaging techniques provide crucial insights into flagellar structure, assembly, and function:

  • Transmission electron microscopy (TEM): Essential for visualizing flagellar structures at high resolution, allowing researchers to confirm the absence of flagella in fliP mutants and analyze structural abnormalities in partial mutants.

  • Cryo-electron microscopy: Provides molecular-level resolution of flagellar structures in their native state without fixation artifacts, potentially revealing novel structural features of R. meliloti's complex flagella.

  • High-speed video microscopy: Critical for analyzing swimming patterns and flagellar dynamics, this technique has been used to document R. meliloti's unique swimming behavior consisting of straight runs and quick directional changes .

  • Fluorescence microscopy with flagellar protein fusions: Allows visualization of flagellar protein localization and assembly dynamics in living cells, providing temporal information about the flagellar assembly process.

  • Total internal reflection fluorescence (TIRF) microscopy: Offers high-resolution imaging of structures near surfaces, useful for studying flagellar rotation of bacteria tethered to microscope slides, as has been done to characterize R. meliloti's clockwise rotation pattern .

  • Super-resolution microscopy: Techniques like STORM or PALM can break the diffraction limit to visualize nanoscale features of flagellar structures that are not visible with conventional microscopy .

What are the most significant unresolved questions regarding FliP function in R. meliloti?

Despite progress in understanding fliP's role in flagellar assembly, several important questions remain unanswered. The precise molecular mechanism by which FliP contributes to protein secretion is not fully understood, including how it recognizes and facilitates the transport of specific flagellar proteins. The three-dimensional structure of R. meliloti FliP has not been resolved, limiting our understanding of its functional domains and interaction surfaces. Additionally, the regulation of fliP expression in response to environmental signals and during different growth phases remains to be elucidated. Another open question is whether FliP has secondary functions beyond flagellar assembly, particularly given its similarity to proteins involved in pathogenicity systems . Future research addressing these knowledge gaps would significantly advance our understanding of bacterial flagellar assembly and protein secretion mechanisms.

How might insights from fliP research inform applications in agricultural biotechnology?

Research on fliP and bacterial motility has potential applications in agricultural biotechnology, particularly for improving biological nitrogen fixation. Understanding how flagellar motility contributes to root colonization efficiency could inform strategies for engineering more effective symbiotic bacteria. Although fliP mutants can still form nitrogen-fixing nodules, their delayed nodulation on some host plants suggests that optimizing motility could enhance symbiotic performance . Furthermore, the similarity between FliP and proteins involved in bacterial pathogenicity suggests that insights from fliP research might inform approaches to enhance plant resistance to bacterial pathogens. By understanding the molecular mechanisms underlying both beneficial and pathogenic plant-microbe interactions, researchers could develop targeted approaches to promote beneficial associations while inhibiting harmful ones . This could contribute to sustainable agricultural practices by reducing dependence on chemical fertilizers and pesticides.

What emerging technologies might advance our understanding of FliP and related flagellar proteins?

Several emerging technologies hold promise for deepening our understanding of FliP and flagellar biology:

  • Single-molecule tracking techniques: These approaches could provide unprecedented insights into the dynamics of flagellar protein assembly and the movement of proteins through the export apparatus, potentially revealing FliP's precise role in this process.

  • In situ structural biology: Methods like cryo-electron tomography can visualize macromolecular complexes within intact cells, potentially capturing the flagellar export apparatus in action and revealing FliP's position and configuration.

  • Systems biology approaches: Integrating transcriptomics, proteomics, and metabolomics data could provide a comprehensive view of how flagellar assembly and function are coordinated with other cellular processes, including responses to environmental signals.

  • Microfluidic devices: These can create precisely controlled microenvironments to study bacterial chemotaxis and surface interactions, allowing detailed analysis of how fliP mutations affect bacterial behavior in complex environments resembling natural habitats.

  • Synthetic biology tools: Designer genetic circuits could help elucidate the regulatory networks controlling fliP expression and flagellar assembly, potentially leading to bacteria with customized motility properties for specific applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.