Recombinant Rhizobium meliloti Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Sequence

The recombinant plsY protein (UniProt ID: Q92QL7) is a full-length enzyme (1–203 aa) with an N-terminal His tag for purification . Its amino acid sequence includes conserved motifs critical for acyltransferase activity and G3P substrate binding .

Key Features:

PropertyDescription
Source OrganismRhizobium meliloti (strain 1021)
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE validated)
Amino Acid SequenceMDMFSWQLGLPSTLACLVFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGATNVLRTGNR...

Functional Role in Lipid Metabolism

PlsY belongs to the glycerol-3-phosphate acyltransferase (GPAT) family, which initiates lipid biosynthesis by converting G3P and acyl-CoA to LPA . In Rhizobium meliloti, this enzyme likely supports membrane lipid synthesis and symbiotic interactions with legumes, such as nitrogen-fixing nodules .

Key Catalytic Steps:

  1. Acylation of G3P:

    Glycerol-3-phosphate+Acyl-CoALysophosphatidic acid (LPA)+CoA\text{Glycerol-3-phosphate} + \text{Acyl-CoA} \rightarrow \text{Lysophosphatidic acid (LPA)} + \text{CoA}
  2. Role in Lipid Diversity:

    • LPA serves as a precursor for phospholipids (e.g., phosphatidylglycerol) and storage lipids (e.g., triacylglycerols) .

    • GPATs in plants and bacteria exhibit substrate preferences, with Rhizobium GPATs potentially influencing membrane fluidity and stress adaptation .

The recombinant plsY is used to study lipid metabolism, symbiosis, and bioengineering.

Experimental Uses:

  • Enzyme Kinetics: Characterizing substrate specificity (e.g., acyl-CoA vs. acyl-ACP) .

  • Symbiotic Studies: Investigating lipid-mediated interactions with legume hosts .

  • Biotechnological Production: Engineering lipid pathways for biofuel precursors or antimicrobial lipids .

Comparative Analysis with Related GPATs

Rhizobium plsY shares conserved motifs with GPATs from other organisms but lacks bifunctional phosphatase activity seen in plant GPATs (e.g., Arabidopsis GPAT4/6) .

Key Differences:

FeatureRhizobium plsYArabidopsis GPAT4/6
Catalytic ProductLPA2-monoacylglycerol (2-MAG)
Phosphatase ActivityAbsentPresent
LocalizationCytoplasmic/membraneEndoplasmic reticulum

Future Research Directions

  1. Symbiotic Lipid Signaling: Elucidating plsY’s role in Rhizobium-legume communication .

  2. Biocatalytic Engineering: Engineering plsY for tailored lipid production (e.g., medium-chain fatty acids) .

  3. Structural Studies: X-ray crystallography to map conserved motifs and substrate-binding sites .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag type, please inform us, and we will prioritize developing that tag according to your request.
Synonyms
plsY; R01302; SMc01362; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
plsY
Target Protein Sequence
MDMFSWQLGLPSTLACLVFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGATNVLRTGNR KLAAATLLFDALKGTAAAAIASYWGVEAGIAAGFAAFLGHLFPVWLSFRGGKGVATYIGV LLGLMPVMVLLFAAIWLAMAKITRYSSLSALVATAAVPIALYAAGNGKVAGLFAVMTAIA WIKHRANIQRLLSGTESRIGEKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what role does it play in bacterial membranes?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme in bacterial membrane phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acylphosphate to glycerol-3-phosphate, forming lysophosphatidic acid, which is the first step in phosphatidic acid formation. This reaction represents one of the most widely distributed biosynthetic pathways for initiating phospholipid synthesis in bacterial membranes. The bacterial pathway typically involves the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the transfer of the acyl group to glycerol 3-phosphate by PlsY, an integral membrane protein.

What is the membrane topology of plsY and how does it relate to its function?

Studies on PlsY from Streptococcus pneumoniae reveal that it has five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane. The enzyme has three larger cytoplasmic domains, each containing a highly conserved sequence motif essential for catalysis. This specific membrane topology is crucial for its function, as it positions the catalytic domains appropriately within the cell to interact with substrates. While this topology has been established for S. pneumoniae PlsY, researchers working with Rhizobium meliloti should conduct comparative analyses to determine if the membrane architecture is conserved across species.

What are the conserved motifs in plsY and what are their functional significance?

PlsY contains three conserved sequence motifs that are critical for its catalytic function:

  • Motif 1: Contains essential serine and arginine residues necessary for enzyme activity.

  • Motif 2: Has characteristics of a phosphate-binding loop and corresponds to the glycerol 3-phosphate binding site. Mutations of conserved glycines in this motif to alanines result in a Km defect for glycerol 3-phosphate binding.

  • Motif 3: Contains a conserved histidine and asparagine important for activity, and a glutamate critical to the structural integrity of PlsY.

These motifs represent potential targets for site-directed mutagenesis studies to understand enzyme function in Rhizobium meliloti specifically.

What expression systems are most effective for producing recombinant Rhizobium meliloti plsY?

For effective expression of recombinant Rhizobium meliloti plsY, researchers should consider several factors:

  • Host selection: While E. coli is commonly used, expression in related Rhizobium species might provide more natural post-translational modifications.

  • Vector design: Include appropriate promoters that work efficiently in the chosen host.

  • Tag selection: Consider the incorporation of affinity tags (His, GST) that don't interfere with membrane insertion or activity.

  • Expression conditions: Optimize temperature, induction time, and inducer concentration.

When working with membrane proteins like plsY, using mild detergents during extraction and purification is crucial to maintain protein structure and function. Based on available protocols for similar proteins, a recommended starting point would be expression in E. coli BL21(DE3) using a pET-based vector system with induction at lower temperatures (16-20°C) to enhance proper folding of the membrane protein.

How can researchers accurately assess the enzyme activity of recombinant plsY?

Accurate assessment of plsY enzyme activity can be achieved through several complementary approaches:

MethodPrincipleAdvantagesLimitations
Radioisotope assayMeasures incorporation of radiolabeled acyl groups into lysophosphatidic acidHigh sensitivity, quantitativeRequires specialized equipment, safety concerns
HPLC analysisSeparates and quantifies reaction productsGood for product characterizationLess sensitive than radioisotope methods
Coupled enzyme assaysLinks plsY activity to measurable changes in cofactor concentrationsCan be adapted to high-throughput formatPotential interference from coupling enzymes
Mass spectrometryDirectly identifies and quantifies reaction productsHighly specific, can identify novel productsExpensive equipment, complex data analysis

For optimal results, researchers should perform enzyme assays under conditions that mimic the native environment of plsY, including appropriate pH, temperature, and membrane-like conditions (e.g., liposomes or detergent micelles). When studying plsY inhibition, note that the enzyme is noncompetitively inhibited by palmitoyl-CoA, which should be considered when designing and interpreting experiments.

What are the most effective approaches for site-directed mutagenesis studies of plsY?

For conducting site-directed mutagenesis studies of Rhizobium meliloti plsY, researchers should:

  • Target selection: Focus on the three conserved motifs identified in structural studies. Based on previous research, priority targets include:

    • Serine and arginine residues in Motif 1

    • Glycine residues in the phosphate-binding loop of Motif 2

    • Histidine, asparagine, and glutamate residues in Motif 3

  • Mutagenesis strategy: Use PCR-based site-directed mutagenesis or newer CRISPR-based approaches for precise genomic editing.

  • Functional analysis: Employ multiple approaches to assess the impact of mutations:

    • In vitro enzyme activity assays comparing wild-type and mutant proteins

    • Growth complementation assays in plsY-deficient strains

    • Thermal stability assays to assess structural impacts

    • Substrate binding studies to determine changes in affinity

  • Structural validation: When possible, complement functional studies with structural analyses (X-ray crystallography or cryo-EM) to directly observe the impact of mutations on protein conformation.

How does plsY from Rhizobium meliloti compare structurally and functionally to counterparts in other bacterial species?

Comparative analysis of plsY across bacterial species reveals both conserved features and important variations:

Experimental approaches for comparative studies should include heterologous expression of plsY from different species in a common host, followed by detailed biochemical characterization under identical conditions.

What approaches should be used to investigate the potential role of plsY in symbiotic relationships of Rhizobium meliloti?

Investigating plsY's role in symbiotic relationships requires specialized approaches:

  • Controlled mutation studies: Generate plsY mutants with altered activity levels rather than complete knockouts, which might be lethal. Use techniques like:

    • Temperature-sensitive mutants

    • Inducible expression systems

    • Partial activity mutants targeting non-essential residues

  • Host plant co-culture experiments: Assess how plsY mutations affect:

    • Nodule formation efficiency with alfalfa (Medicago sativa)

    • Nitrogen fixation rates

    • Bacterial survival within nodules

    • Membrane lipid composition during symbiosis

  • Environmental factor analysis: Examine how environmental stressors affect plsY activity during symbiosis:

    • pH fluctuations

    • Oxygen limitation

    • Nutrient availability (especially phosphate)

    • Plant defense responses

  • Comparative genomics: Compare plsY sequences and regulation across Rhizobium strains with different host specificities and symbiotic efficiencies.

Previous research has shown that biotin availability can significantly impact the growth of Rhizobium meliloti in the alfalfa rhizosphere, suggesting metabolic adaptations are crucial for symbiotic success. Similar adaptations in phospholipid metabolism involving plsY may play important roles in establishing successful symbiotic relationships.

How might alterations in plsY activity affect membrane composition and bacterial stress responses?

Alterations in plsY activity can have significant impacts on membrane composition and stress responses:

  • Membrane fluidity changes: Altered acyltransferase activity can change the fatty acid composition of membrane phospholipids, affecting:

    • Membrane fluidity at different temperatures

    • Permeability to small molecules

    • Resistance to membrane-disrupting agents

  • Stress response mechanisms: Changes in membrane composition due to altered plsY function may affect:

    • Heat shock response pathways

    • Osmotic stress tolerance

    • Resistance to antimicrobial compounds

    • Biofilm formation capacity

  • Metabolic implications: Beyond direct membrane effects, altered plsY activity may impact:

    • Energy expenditure for lipid biosynthesis

    • Carbon flux through central metabolism

    • Accumulation of potential toxic intermediates

Research methodologies should include lipidomic analyses to quantify changes in membrane composition under various conditions, coupled with transcriptomic or proteomic approaches to identify compensatory mechanisms employed by the bacteria in response to altered plsY function.

What are the common technical challenges in purifying active recombinant plsY and how can they be overcome?

Purifying active recombinant plsY presents several technical challenges due to its integral membrane nature:

  • Solubilization issues: As an integral membrane protein with five membrane-spanning segments, plsY is inherently difficult to solubilize while maintaining activity.

    • Solution: Screen multiple detergents (DDM, CHAPS, digitonin) at various concentrations. Consider using amphipols or nanodiscs for stabilization after purification.

  • Expression levels: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host; use specialized strains designed for membrane protein expression (e.g., C41/C43 for E. coli); test different fusion partners that can enhance folding.

  • Protein misfolding: Improper insertion into membranes leads to inactive protein.

    • Solution: Express at lower temperatures (16-20°C); use slow induction protocols; add specific lipids to the growth medium that may facilitate proper folding.

  • Activity loss during purification: The enzyme may lose activity during purification steps.

    • Solution: Minimize time between steps; maintain constant low temperature; include glycerol (20-25%) and specific lipids in all buffers; consider purifying in the presence of substrates or substrate analogs.

  • Storage stability: Purified membrane proteins often lose activity during storage.

    • Solution: Store at -80°C in buffer containing 50% glycerol; alternatively, store the protein in membrane fractions rather than as a purified protein.

How can researchers effectively study the inhibition kinetics of plsY?

Studying inhibition kinetics of plsY requires careful experimental design:

  • Assay optimization:

    • Establish linear reaction conditions with respect to time and enzyme concentration

    • Determine optimal substrate concentrations based on Km values

    • Develop a reliable, preferably continuous assay format for kinetic measurements

  • Inhibitor screening approaches:

    • Start with known inhibitors like palmitoyl-CoA, which noncompetitively inhibits plsY

    • Use rational design based on substrate analogs

    • Consider high-throughput screening with compound libraries if available

  • Kinetic analysis procedures:

    • For each potential inhibitor, determine IC50 values

    • Perform detailed kinetic analysis to determine inhibition type (competitive, noncompetitive, uncompetitive)

    • Generate Lineweaver-Burk, Dixon, and Cornish-Bowden plots for accurate inhibition constant (Ki) determination

  • Data interpretation considerations:

    • Account for potential membrane/detergent interactions with inhibitors

    • Validate in vitro findings with whole-cell assays when possible

    • Compare inhibition patterns across plsY from different bacterial species

What approaches should be used for troubleshooting inconsistent results in plsY activity assays?

When facing inconsistent results in plsY activity assays, researchers should implement a systematic troubleshooting approach:

ProblemPotential CausesTroubleshooting Steps
No detectable activityInactive enzyme, improper assay conditionsVerify protein integrity by SDS-PAGE; check pH and buffer composition; ensure substrate quality; include positive control
Variable activity levelsProtein instability, variable substrate qualityPrepare fresh enzyme for each experiment; standardize protein quantification; use internal standards; prepare master mixes
Non-linear reaction kineticsProduct inhibition, enzyme instabilityReduce reaction time; lower enzyme concentration; remove products continuously if possible
Poor reproducibility between experimentsBuffer variability, temperature fluctuationStandardize buffer preparation; control temperature strictly; use automated liquid handling if available
Activity loss during storageProtein denaturation, oxidationAdd reducing agents; avoid freeze-thaw cycles; store as aliquots; test stabilizing additives

Additionally:

  • Maintain detailed records of all experimental variables

  • Test multiple batches of the enzyme in parallel

  • Consider environmental factors like light exposure and vessel material

  • Validate key findings using alternative assay methods

What emerging technologies could advance our understanding of plsY structure-function relationships?

Several emerging technologies hold promise for deeper insights into plsY structure-function relationships:

  • Cryo-electron microscopy: Recent advances in cryo-EM allow for high-resolution structural determination of membrane proteins without crystallization. This could provide unprecedented insights into plsY conformation in different functional states.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can reveal dynamics and conformational changes in proteins upon substrate binding or during catalysis, potentially identifying previously unknown functional regions of plsY.

  • Molecular dynamics simulations: With improved force fields for membrane proteins, MD simulations can now predict how mutations affect protein dynamics and substrate interactions at atomic resolution.

  • Native mass spectrometry: This approach allows for analysis of intact membrane protein complexes, potentially revealing previously unknown interaction partners of plsY.

  • In-cell NMR spectroscopy: This developing technique could eventually allow for studying plsY dynamics in its native cellular environment.

These technologies could be particularly valuable for understanding how the three conserved motifs in plsY coordinate for catalysis and how the enzyme's activity is regulated in response to cellular needs.

How might comparative genomics and phylogenetic analyses contribute to plsY research?

Comparative genomics and phylogenetic approaches offer valuable insights for plsY research:

  • Evolutionary conservation analysis: By comparing plsY sequences across diverse bacterial lineages, researchers can identify:

    • Ultra-conserved residues likely essential for catalysis

    • Lineage-specific adaptations potentially related to ecological niches

    • Co-evolution patterns with other proteins in the phospholipid biosynthesis pathway

  • Genomic context analysis: Examining the genomic neighborhood of plsY across species can reveal:

    • Potential operon structures and co-regulated genes

    • Novel genes functionally related to phospholipid metabolism

    • Regulatory elements that control plsY expression

  • Horizontal gene transfer assessment: Analyzing the evolutionary history of plsY can:

    • Identify instances of horizontal gene transfer

    • Reveal potential adaptations to specific environmental conditions

    • Help understand the diversification of phospholipid biosynthesis pathways

  • Structure prediction improvement: Multiple sequence alignments from diverse species can:

    • Improve homology modeling of plsY structure

    • Identify co-varying residues that may interact functionally

    • Guide rational design of mutations for functional studies

These approaches are particularly important for understanding Rhizobium meliloti plsY in the context of its symbiotic lifestyle and adaptation to soil environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.