Recombinant Rhizobium meliloti Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Membrane Protein Insertion

YidC operates via two pathways:

  • Sec-Independent Insertion: Directly integrates single-spanning proteins (e.g., Pf3 coat protein) into membranes without Sec translocon involvement .

  • Sec-Dependent Chaperoning: Collaborates with SecYEG to fold polytopic proteins (e.g., MelB permease) .

Key mechanisms include:

  • Electrostatic Guidance: Positively charged residues (e.g., R72) attract negatively charged substrate regions .

  • Hydrophobic Partitioning: Accelerates insertion of hydrophobic transmembrane domains into lipid bilayers .

In Vitro Studies

  • Proteoliposome Reconstitution: E. coli YidC inserted 150 Pf3 coat proteins per YidC molecule in liposomes, demonstrating catalytic activity .

  • Single-Molecule Force Spectroscopy: Revealed YidC’s role in preventing misfolding of polytopic proteins like MelB .

In Vivo Applications

  • Commercial Availability: Recombinant Rhizobium meliloti YidC is marketed as an ELISA reagent (CSB-CF853080RKU), highlighting its use in immunological assays .

Applications and Implications

Outstanding Questions and Future Directions

  • Species-Specific Adaptations: Structural and functional differences between R. meliloti and E. coli YidC remain unexplored.

  • Engineering Potential: Modifying YidC’s hydrophilic groove could enhance its utility in membrane protein production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; R00444; SMc01721; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-594
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
yidC
Target Protein Sequence
MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEQAQQAQQTQQQPGAQPAAPGQA LPGGAIPSAGESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSPVI TLFSPAETADGYFTEIGYIGSDATGSVPGPQTTWTLSGGDKLTPSTPVTLSYTNDKGITF ARTISVDDRYMFQVVDSIKNETAAPVSLSSYGRVTRFNKPTTPSIYVLHEGFVGVAGEHG LQEVGYSKVEDDEPVEPGKSTGGWLGITDKYWAATIVPPQATPFDIRFSHFADGRPRYQS DYKSDAVTVAPGQSVELKNLVFAGAKEVPVVDNYEVAYSIPNFDKLIDWGWFYFITKPMF KMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGDDR MGLQQAMMQLYKEEKINPLAGCWPILIQIPVFFALYKVIYVTIEMRHAPFFGWIQDLSAP DPTTIINLFGLLPFEGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPVVFT FMLASFPAGLVIYWAWNNTLSILQQGIIMKRQGVKVELFDNLKSLFSKKPKPAE
Uniprot No.

Target Background

Function

Function: Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a role in the integration of membrane proteins that utilize both Sec-dependent and Sec-independent pathways, including certain lipoproteins. Additionally, it aids in the folding of multispanning membrane proteins.

Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in bacterial cells?

YidC is an essential insertase and chaperone that belongs to the highly conserved Oxa1 superfamily, with homologues present across all kingdoms of life . Its primary function involves facilitating the insertion and folding of proteins into the cytoplasmic membrane, which is crucial for cell viability . YidC significantly influences both membrane protein composition and lipid organization within the bacterial inner membrane . It serves dual roles - working in conjunction with the Sec translocon to aid proper folding of multi-pass membrane proteins, and functioning independently as both an insertase and lipid scramblase to enhance insertion of smaller membrane proteins while contributing to bilayer organization .

How does YidC function in relation to the Sec translocon?

YidC can operate through two distinct pathways in bacteria. In one pathway, it functions as part of the Sec holo-translocon, a multi-protein complex that inserts polytopic membrane proteins into the cytoplasmic membrane . The Sec translocon consists of subunits SecY, SecE, and SecG, along with accessory proteins . Alternatively, YidC can act independently of the Sec machinery to facilitate the insertion and folding of primarily smaller membrane proteins with single or double membrane spans . Interestingly, despite this typical division of labor, research has demonstrated that YidC can promote the insertion and folding of complex polytopic membrane proteins such as lactose permease (LacY) and melibiose permease (MelB), indicating significant functional flexibility .

What are the key structural features of YidC that enable its insertase function?

While the search results don't explicitly detail YidC's structural features, they indicate that YidC possesses unique characteristics that allow it to serve both as an insertase and a chaperone . YidC's structure enables it to accelerate and guide the stepwise insertion and folding process of membrane proteins, particularly in regions prone to misfolding . Its ability to function as a lipid scramblase additionally contributes to membrane organization . The structure likely facilitates interactions with both the Sec translocon and directly with substrate proteins, allowing for the remarkable functional versatility observed across experimental studies .

What experimental evidence supports YidC's role in polytopic membrane protein folding?

In vivo experiments using conditionally depleted E. coli strains have demonstrated that melibiose permease (MelB) can insert into membranes in the absence of SecYEG, provided YidC is present in the cytoplasmic membrane . More detailed insights have come from in vitro single-molecule force spectroscopy, which revealed that the MelB substrate forms two distinct folding cores from which structural segments insert stepwise into the membrane . These experiments showed that without YidC, misfolding dominates, particularly in structural regions that interface the pseudo-symmetric α-helical domains of MelB . YidC's presence was shown to accelerate and chaperone the stepwise insertion and folding process of both MelB folding cores, demonstrating its critical role in preventing misfolding and ensuring proper membrane protein integration .

How does YibN interact with YidC and what are the functional implications?

YibN has been identified as a crucial component within the YidC protein environment through proximity-dependent biotin labeling (BioID) techniques . The physical association between YidC and YibN has been confirmed through multiple experimental approaches, including affinity purification-mass spectrometry assays conducted on native membranes and on-gel binding assays with purified proteins . Functionally, co-expression studies and in vitro assays have demonstrated that YibN enhances the production and membrane insertion of various YidC substrates, including M13 and Pf3 phage coat proteins, ATP synthase subunit c, and small membrane proteins like SecG . Beyond protein insertion, YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC's lipid scramblase activity . These findings establish YibN as a significant physical and functional interactor of YidC that influences both membrane protein insertion and lipid organization.

What methodologies have been most effective for studying YidC-dependent membrane protein insertion?

Research into YidC function has employed complementary in vivo and in vitro approaches. In vivo studies have utilized conditionally depleted E. coli strains to assess the functionality of membrane proteins in the presence or absence of YidC . A particularly powerful technique has been single-molecule force spectroscopy using atomic force microscopy, which has allowed researchers to monitor the stepwise insertion and folding of membrane proteins like MelB and to characterize folding pathways and domains . Other effective methodologies include proximity-dependent biotin labeling (BioID) for identifying protein interactions in the native membrane environment, affinity purification coupled with mass spectrometry, and on-gel binding assays with purified proteins . In vitro reconstitution systems have also proven valuable for assessing the direct effects of YidC on substrate insertion without cellular complexity . This multi-faceted approach combining structural, biochemical, and biophysical techniques has been crucial for elucidating YidC's complex role in membrane protein biogenesis.

What is the significance of biotin for Rhizobium meliloti growth?

Biotin plays a critical role in Rhizobium meliloti growth, particularly in the rhizosphere environment. Experimental studies have demonstrated that R. meliloti 1021 growth in an alfalfa (Medicago sativa L.) rhizosphere is significantly stimulated by the addition of nanomolar amounts of biotin . This indicates that biotin acts as a limiting nutrient for R. meliloti in its natural environment, affecting the bacterium's ability to colonize and potentially form symbiotic relationships with host plants . The importance of biotin for R. meliloti growth contrasts with other bacterial species that can synthesize sufficient biotin for their needs, highlighting a potential evolutionary adaptation specific to this rhizobial species and its ecological niche .

What molecular mechanisms might explain the viability loss in recombinant R. meliloti strains with enhanced biotin production?

The dramatic loss of viability (up to 99%) observed in recombinant R. meliloti strain Rm1021-WS11 despite its increased growth rate suggests complex metabolic consequences of biotin overproduction . Several molecular mechanisms could explain this phenomenon. Overexpression of the E. coli biotin operon may create metabolic burden by diverting cellular resources toward unnecessary biotin synthesis . This is supported by similar findings in E. coli, where overexpression of the biotin operon causes growth inhibition . Excessive biotin might also disrupt normal cellular processes by oversaturating biotin-dependent enzymes or altering membrane permeability. The observation that strain Rm1021-WS10 showed lower viability loss suggests that specific factors in the transferred E. coli DNA may mitigate these negative effects, possibly by regulating expression levels or providing complementary metabolic pathways that balance the cellular stress induced by biotin overproduction .

Why do recombinant R. meliloti strains with enhanced in vitro growth perform poorly in rhizosphere conditions?

The poor performance of recombinant R. meliloti strains in rhizosphere tests despite their enhanced in vitro growth represents a classic example of laboratory versus ecological fitness divergence . Several factors may contribute to this phenomenon. First, the metabolic burden of maintaining and expressing the E. coli biotin synthesis operon might reduce resources available for coping with the complex, variable conditions of the rhizosphere environment . Second, the physiological instability observed in these strains (evidenced by their viability loss) would be particularly detrimental in competitive natural settings. Third, the overproduction of biotin might disrupt signaling pathways critical for plant-microbe interactions or alter the expression of genes involved in rhizosphere colonization . Finally, the integration of foreign DNA might have unknown pleiotropic effects on genes important for competitive fitness in the rhizosphere. This research highlights the importance of testing agricultural inoculants under realistic field conditions, as laboratory performance can be a poor predictor of ecological success .

What methodological approaches could improve recombinant strain stability while maintaining enhanced biotin production?

To improve the stability of recombinant R. meliloti strains while maintaining their enhanced biotin production, several methodological approaches could be employed. Based on observations that strain Rm1021-WS10 exhibited better viability than Rm1021-WS11, researchers could identify and characterize the stabilizing factors in E. coli DNA that conferred this advantage . Implementing controlled expression systems such as inducible promoters could help regulate biotin operon expression to levels that enhance growth without causing toxicity. Codon optimization of the E. coli biotin synthesis genes for R. meliloti could improve translation efficiency and reduce metabolic burden . Alternative genetic engineering approaches could involve modifying native R. meliloti biotin synthesis regulation rather than introducing heterologous pathways. Integration of the biotin operon into the chromosome rather than using plasmid vectors might also improve stability. Finally, directed evolution approaches could select for recombinant strains that maintain enhanced biotin production while recovering competitive fitness in rhizosphere conditions .

What are the key experimental techniques for investigating YidC-substrate interactions?

Investigating YidC-substrate interactions requires a complementary set of experimental techniques. Single-molecule force spectroscopy using atomic force microscopy has proven particularly valuable for directly observing the stepwise insertion and folding processes of membrane proteins, allowing researchers to characterize folding pathways, energetics, and the influence of YidC on these processes . Proximity-dependent biotin labeling (BioID) has been effectively employed to identify proteins that physically interact with YidC in the native membrane environment . Affinity purification coupled with mass spectrometry provides another approach for identifying YidC interaction partners from cellular lysates . For direct protein-protein interaction confirmation, on-gel binding assays with purified proteins offer a reductionist method that eliminates confounding cellular factors . Conditional depletion systems in E. coli have enabled assessment of YidC's functional importance for specific substrate proteins in vivo . Together, these techniques provide a powerful toolkit for dissecting the complex interactions between YidC and its various substrate proteins.

How can researchers effectively design experiments to investigate membrane protein folding mechanisms?

Effective experimental design for investigating membrane protein folding mechanisms requires careful consideration of several factors. First, selecting appropriate model proteins with well-characterized structures, such as melibiose permease (MelB), provides a foundation for interpreting folding results . Researchers should employ complementary in vivo and in vitro approaches, as neither alone provides a complete picture. In vivo studies using conditionally depleted strains can establish physiological relevance, while in vitro studies using purified components allow precise mechanistic investigations . When designing single-molecule force spectroscopy experiments, careful attention must be paid to protein extraction, force application parameters, and data analysis to distinguish folding intermediates from experimental artifacts . Including appropriate controls, such as comparing wild-type and mutant proteins or varying the presence of insertases like YidC, helps establish causality in observed folding phenomena. Finally, integrating structural information with functional assays provides the most comprehensive understanding of membrane protein folding mechanisms .

What are the current limitations in studying YidC function and how might they be overcome?

Despite significant advances, several limitations persist in studying YidC function. One major challenge is that fully unfolded and extracted MelB polypeptide cannot insert and fold into lipid membranes with or without YidC in vitro, suggesting that additional factors present in vivo are required . To overcome this, researchers could develop more complex reconstitution systems that incorporate potential co-chaperones or membrane factors. The field also faces challenges in resolving the real-time dynamics of YidC-mediated insertion at high resolution. Emerging techniques such as cryo-electron microscopy of insertion intermediates or time-resolved single-molecule fluorescence might address this limitation. Another challenge is distinguishing YidC's direct insertase activity from its chaperone function. Designing substrate proteins with specific folding reporters at different positions could help differentiate these functions. Finally, the field lacks a comprehensive understanding of the substrate specificity determinants for YidC-dependent insertion. Systematic mutagenesis of both YidC and various substrates, coupled with quantitative binding and insertion assays, could help establish a predictive model for YidC substrate recognition .

How does YidC function compare across different bacterial species?

While the search results focus primarily on YidC function in E. coli, they mention that YidC belongs to a highly conserved family with homologues in all kingdoms of life . A comprehensive comparative analysis would reveal both conserved and species-specific aspects of YidC function. In different bacterial species, YidC homologues likely maintain the core insertase function but may have evolved specialized roles based on the particular membrane composition and protein clients of each organism. For example, in Gram-positive bacteria like Bacillus subtilis, which lack an outer membrane, the YidC homologues (SpoIIIJ and YqjG) might have adapted to different substrates or membrane environments. In Rhizobium meliloti, which faces specialized environmental challenges in the plant rhizosphere, YidC might have evolved to handle specific membrane proteins involved in plant-microbe interactions . Future comparative studies examining substrate specificity, interaction networks, and functional redundancy across species would provide valuable insights into the evolutionary adaptation of this essential membrane protein biogenesis factor.

What potential exists for integrating research on YidC with studies of Rhizobium meliloti membrane biology?

The integration of research on YidC with studies of Rhizobium meliloti membrane biology presents exciting opportunities for advancing both fields. R. meliloti must maintain specialized membrane proteins for symbiotic interactions with plant hosts, and YidC homologues likely play crucial roles in inserting these proteins. Investigating how YidC contributes to the membrane adaptations required for rhizosphere survival and plant symbiosis could reveal novel insights into both membrane protein biogenesis and plant-microbe interactions . Specific research directions could include: examining how YidC-dependent protein insertion changes during the transition from free-living to symbiotic states; investigating whether YidC interacts with biotin transporters that might influence R. meliloti growth in biotin-limited rhizosphere environments; and exploring whether manipulating YidC activity could improve the performance of recombinant R. meliloti strains engineered for enhanced agricultural properties . Such integrated studies would bridge fundamental membrane biology with applied agricultural microbiology.

What emerging technologies might revolutionize our understanding of membrane protein insertases?

Several emerging technologies hold promise for revolutionizing our understanding of membrane protein insertases like YidC. Cryo-electron microscopy has rapidly advanced to near-atomic resolution and could capture insertion intermediates of YidC with various substrates . Integrative structural approaches combining crystallography, NMR, and computational modeling could provide dynamic views of the insertion process. Single-molecule tracking in living cells using techniques like photoactivated localization microscopy (PALM) could reveal the spatial and temporal dynamics of YidC during membrane protein biogenesis. High-throughput approaches such as deep mutational scanning combined with functional selection could systematically map the sequence determinants of YidC-substrate interactions. Cell-free expression systems coupled with nanodiscs or other membrane mimetics offer controlled environments for mechanistic studies. Finally, the application of artificial intelligence approaches to predict YidC-dependent insertion and to design optimal substrates could accelerate discovery. These technologies, applied to both model organisms like E. coli and ecologically important bacteria like R. meliloti, would substantially advance our understanding of this essential cellular process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.