Recombinant Rhizobium meliloti Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium meliloti Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA)

Recombinant Rhizobium meliloti Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a recombinant protein derived from the bacterium Rhizobium meliloti. This enzyme plays a crucial role in the biosynthesis of peptidoglycan, a key component of bacterial cell walls. Peptidoglycan, also known as murein, provides structural support and maintains the osmotic balance necessary for bacterial survival. The mtgA enzyme is specifically involved in the cross-linking of peptidoglycan layers, which is essential for cell wall integrity and bacterial growth.

Function and Importance of mtgA

The mtgA enzyme in Rhizobium meliloti is responsible for catalyzing the formation of cross-links between peptidoglycan strands. This process is vital for maintaining the structural integrity of the bacterial cell wall, allowing it to withstand environmental pressures and osmotic stress. In Rhizobium meliloti, which forms symbiotic relationships with legume plants, a robust cell wall is crucial for survival and effective symbiosis.

Table: Comparison of Peptidoglycan Transglycosylases

EnzymeOrganismFunctionImportance
mtgARhizobium melilotiPeptidoglycan cross-linkingCell wall integrity, symbiosis
SltSalmonella typhimuriumPeptidoglycan cross-linkingCell wall stability, resistance to antibiotics
MltDSalmonella typhimuriumPeptidoglycan degradationCell wall remodeling, cell division

Applications and Future Directions

The recombinant mtgA enzyme has potential applications in biotechnology and microbiology research. It can be used to study the mechanisms of peptidoglycan synthesis and cell wall formation in bacteria. Additionally, understanding the role of mtgA in Rhizobium meliloti could provide insights into improving symbiotic relationships between rhizobia and legume plants, enhancing nitrogen fixation and agricultural productivity.

References

  1. ELISA Recombinant Rhizobium meliloti Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA): Available from colorectalresearch.com.

  2. Membrane-bound lytic murein transglycosylase - Rhizobium meliloti: UniProtKB entry Q92M47.

  3. Peptidoglycan recycling mediated by an ABC transporter in the plant pathogen Xanthomonas oryzae: PMC9790009.

  4. Molecular Microbiology: Wiley Online Library, discussing peptidoglycan-modifying enzymes.

  5. Role of LPS and peptidoglycan monomers in the symbiotic relationship: SciSpace.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; R03266; SMc03883; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
mtgA
Target Protein Sequence
MPAGRWTATRRTWRSRRRRLVFIVLSVLILPYALIGLYLLEFIHPVSTLMLRDLVLLRGY DRQWVEFDDIAPVLVQSVMMSEDGQFCAHAGIDWAQMRGVVEDALDGEQTRGASTIPMQT VKNLFLWNGRSFVRKAMELPLAIAADFAWSKRRLMEIYLNVAEWGEGIYGIEAAARHHFG VSAAKLSRRQAALLAVSLPNPIDRTAGKPGRGLRRLAAVIERRAGRSGGYITCLYD
Uniprot No.

Target Background

Function
Recombinant *Rhizobium meliloti* Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How is mtgA classified enzymatically and what is its role in bacterial cell wall biosynthesis?

Rhizobium meliloti mtgA is enzymatically classified as EC 2.4.2.-, indicating it belongs to the glycosyltransferase family. As a monofunctional biosynthetic peptidoglycan transglycosylase, it catalyzes the polymerization of lipid II precursors to form the glycan chains of peptidoglycan, a crucial component of bacterial cell walls . Unlike bifunctional transglycosylases, it lacks transpeptidase activity and focuses exclusively on glycosidic bond formation, making it an important component in the multi-enzyme machinery responsible for bacterial cell wall synthesis.

What are the optimal storage conditions for recombinant mtgA to maintain enzymatic activity?

For optimal storage of recombinant Rhizobium meliloti mtgA, the following conditions are recommended:

  • Short-term storage (up to one week): 4°C in working aliquots

  • Medium-term storage: -20°C in Tris-based buffer with 50% glycerol

  • Long-term storage: -80°C in Tris-based buffer with 50% glycerol

It's important to note that repeated freezing and thawing should be avoided as it can significantly reduce enzyme activity . The storage buffer is specifically optimized for this protein, and the high glycerol concentration (50%) acts as a cryoprotectant to maintain proper folding and activity during freeze-thaw cycles.

What are the methodological approaches for isolating and purifying native mtgA from Rhizobium meliloti cultures?

The isolation of native mtgA from Rhizobium meliloti requires a multi-step approach:

  • Bacterial Culture Preparation:

    • Grow Rhizobium meliloti (strain 1021) under standard conditions in tryptone-yeast (TY) media at 30°C for 48 hours .

    • Harvest cells by centrifugation when cultures reach mid-logarithmic phase.

  • Cell Membrane Fractionation:

    • Disrupt cells using a French press or sonication in a buffer containing protease inhibitors.

    • Separate membrane fractions through differential centrifugation.

    • Enrich for membranes containing mtgA through sucrose gradient ultracentrifugation.

  • Protein Extraction and Purification:

    • Solubilize membrane proteins using mild detergents (e.g., CHAPS or n-dodecyl-β-D-maltoside).

    • Employ ion-exchange chromatography followed by affinity chromatography.

    • Confirm purity through SDS-PAGE and Western blotting using antibodies against mtgA.

This protocol must be performed at 4°C whenever possible to minimize protein degradation.

How can researchers design assays to measure the transglycosylase activity of mtgA in vitro?

To measure the transglycosylase activity of Rhizobium meliloti mtgA in vitro, researchers can implement the following methodological approach:

  • Substrate Preparation:

    • Synthesize or obtain fluorescently labeled lipid II analogs (e.g., dansylated or BODIPY-labeled lipid II).

    • Prepare lipid II micelles or incorporate into liposomes to mimic membrane environment.

  • Reaction Setup:

    • Incubate purified mtgA (50-200 ng) with fluorescent lipid II (1-5 μM) in a buffer containing:

      • 50 mM HEPES, pH 7.5

      • 10 mM MgCl₂

      • 100 mM NaCl

      • 0.05% Triton X-100 or appropriate detergent

  • Activity Measurement Methods:

    • FRET-based assay: Use donor-quencher labeled lipid II that exhibits fluorescence upon polymerization.

    • HPLC analysis: Detect polymerized products using size-exclusion chromatography.

    • SDS-PAGE with fluorescence detection: Visualize polymeric products by their reduced mobility.

  • Controls and Validation:

    • Include positive controls (known transglycosylases like E. coli PBP1A).

    • Use negative controls (heat-inactivated enzyme).

    • Confirm specificity by testing inhibitors like moenomycin.

The assay should be performed at 30°C to reflect the optimal growth temperature of Rhizobium meliloti.

What genetic approaches can be used to study mtgA function in vivo?

Several genetic approaches can be employed to study mtgA function in Rhizobium meliloti:

  • Gene Knockout Studies:

    • Generate mtgA deletion mutants using homologous recombination.

    • Employ CRISPR-Cas9 systems optimized for rhizobia.

    • Analyze resulting phenotypes (growth rates, cell morphology, symbiotic efficiency).

  • Conditional Expression Systems:

    • Create strains with mtgA under inducible promoters (tetracycline-responsive or rhamnose-inducible systems).

    • Monitor effects of mtgA depletion on cell wall synthesis and bacterial growth.

  • Complementation Experiments:

    • Complement knockout strains with wild-type or mutant versions of mtgA.

    • Introduce point mutations to identify critical residues for enzyme function.

  • Fluorescence Microscopy:

    • Generate fusions with fluorescent proteins (GFP, mCherry) to track mtgA localization.

    • Use fluorescent D-amino acids to visualize peptidoglycan synthesis patterns.

  • Symbiosis Assays:

    • Assess the ability of mtgA mutants to form effective nodules on Medicago hosts.

    • Quantify nitrogen fixation efficiency using acetylene reduction assays .

These approaches provide comprehensive insights into mtgA function within the living bacterial cell and its role in symbiotic interactions.

How does mtgA expression in Rhizobium meliloti vary during different stages of symbiosis with legume hosts?

Expression of mtgA in Rhizobium meliloti undergoes significant regulation during the establishment of symbiosis with legume hosts like Medicago truncatula. Analyzing this variation requires a stage-specific approach:

  • Free-living Stage:

    • Baseline expression occurs during normal growth in soil.

    • Regulated primarily by cell division requirements.

  • Rhizosphere Colonization:

    • Moderate upregulation in response to root exudates.

    • Expression coordinated with other genes on the pSymB chromid, which carries genes important for rhizosphere environments .

  • Infection Thread Formation:

    • Significant upregulation as bacteria modify their cell walls.

    • Expression coordinated with other cell envelope modification genes.

  • Bacteroid Differentiation:

    • Altered expression pattern during transformation into nitrogen-fixing bacteroids.

    • Cell wall remodeling requires precise regulation of peptidoglycan synthesis.

  • Mature Nodule Stage:

    • Maintenance expression to support bacteroid persistence.

Researchers can quantify these expression changes using RNA-seq or qRT-PCR with samples collected at each developmental stage from both laboratory cultures and nodules at different maturation stages.

What is the relationship between mtgA activity and the ability of Rhizobium meliloti to establish successful symbiosis?

The relationship between mtgA activity and successful symbiosis establishment is complex and multifaceted:

  • Cell Wall Integrity During Infection:

    • Proper peptidoglycan synthesis is crucial for bacterial survival during host infection process.

    • Defects in peptidoglycan structure can trigger host defense responses that abort symbiosis.

  • Bacteroid Differentiation Requirements:

    • As bacteria transform into bacteroids, cell wall remodeling mediated by transglycosylases including mtgA becomes essential.

    • The enzymatic activity must be precisely regulated to allow for differentiation without compromising cellular integrity.

  • Host Recognition Factors:

    • Peptidoglycan fragments released during cell wall remodeling may serve as signaling molecules.

    • These fragments can be recognized by host plant pattern recognition receptors, influencing symbiotic compatibility.

  • Correlation with Symbiotic Efficiency:

    • Studies comparing highly efficient versus inefficient strains often reveal differences in cell wall-related gene expression.

    • The tripartite genome of Rhizobium meliloti shows that while the chromosome carries core metabolic functions, symbiotic genes are primarily located on the pSymA element, suggesting complex regulatory interactions between these genomic components during symbiosis .

Experimental approaches to study this relationship typically involve creating mtgA mutants with varied expression levels and assessing their nodulation efficiency and nitrogen fixation capacity on host plants.

How does the structure and function of Rhizobium meliloti mtgA compare to homologous enzymes in other bacterial species?

A comparative analysis of Rhizobium meliloti mtgA with homologous enzymes reveals important structural and functional relationships:

Bacterial SpeciesProtein Size (aa)Sequence Identity to R. meliloti mtgAKey Functional DifferencesGenomic Context
Rhizobium meliloti236100%Reference proteinLocated on chromosome
Escherichia coli~250~35-40%Better characterized kineticallySingle chromosome
Bacillus subtilis~220~30%Functions in sporulationSingle chromosome
Agrobacterium tumefaciens~240~75-80%Plant pathogen contextMultipartite genome
Brucella species~230~65%Pathogenesis-related modificationsBipartite genome

Key structural similarities include:

  • Conservation of catalytic domain architecture

  • Preservation of essential glycosyltransferase motifs

  • Similar transmembrane topology

Notable functional differences:

  • Rhizobial mtgA may have evolved to function optimally during symbiotic interactions

  • Expression regulation systems differ significantly between free-living bacteria and symbionts

  • Substrate specificity may be adapted to the unique peptidoglycan composition of rhizobia

This comparative analysis provides insights into both conserved mechanisms of peptidoglycan synthesis and specialized adaptations that may contribute to the symbiotic lifestyle of Rhizobium meliloti.

What is known about the evolutionary history of mtgA in the Rhizobiaceae family?

The evolutionary history of mtgA in Rhizobiaceae reveals important insights about bacterial adaptation:

  • Phylogenetic Analysis:

    • mtgA belongs to a family of glycosyltransferases that likely originated before the diversification of alphaproteobacteria.

    • Sequence analysis suggests vertical inheritance as the primary evolutionary mechanism within Rhizobiaceae.

    • Synteny analysis shows conserved genomic neighborhoods across related species, supporting orthologous relationships.

  • Genome Organization Context:

    • In Rhizobium meliloti, mtgA is located on the main chromosome rather than on symbiotic plasmids or chromids.

    • This chromosomal location is consistent with it serving a core cellular function predating the evolution of symbiosis .

    • The gene is positioned within the genomic region containing other cell wall biosynthesis genes.

  • Selection Pressure Analysis:

    • The catalytic domain shows strong purifying selection, indicating functional conservation.

    • N-terminal regions exhibit greater sequence variation, potentially relating to species-specific regulatory mechanisms.

    • dN/dS ratios are typically below 1.0, consistent with conservation of function.

  • Comparison to Related Species:

    • Ensifer (Sinorhizobium) species show highest sequence identity (~90-95%).

    • More distant Rhizobium species maintain moderate identity (~70-80%).

    • Key functional residues are invariant across the family.

This evolutionary analysis supports the view that mtgA represents an ancient and essential gene that has been maintained throughout Rhizobiaceae evolution while potentially acquiring specialized features in symbiotic lineages.

What are the crucial methodological considerations when expressing recombinant Rhizobium meliloti mtgA in heterologous systems?

Expressing recombinant Rhizobium meliloti mtgA in heterologous systems presents several technical challenges that require methodological attention:

  • Expression System Selection:

    • Prokaryotic Systems:

      • E. coli BL21(DE3) or its derivatives are commonly used for initial expression attempts.

      • Rhizobial expression hosts (e.g., Sinorhizobium meliloti 1021) provide native cellular machinery but lower yields.

    • Eukaryotic Systems:

      • Yeast (P. pastoris) can be considered for complex post-translational modifications.

      • Insect cell systems may improve folding of membrane-associated domains.

  • Vector Design Considerations:

    • Include an appropriate signal sequence for membrane targeting.

    • Consider fusion tags:

      • N-terminal tags (His6, MBP) can improve solubility.

      • C-terminal tags minimize interference with signal sequences.

    • Use inducible promoters (T7, tac, araBAD) with tunable expression levels.

  • Expression Optimization:

    • Codon optimization for the host organism improves translation efficiency.

    • Lower induction temperatures (16-20°C) enhance proper folding.

    • Consider co-expression with chaperones for membrane proteins.

  • Purification Strategy:

    • Two-phase extraction with detergents for membrane-associated forms.

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs.

    • Size exclusion chromatography as a final polishing step.

  • Functional Validation:

    • Enzymatic activity assays using fluorescent lipid II substrates.

    • Circular dichroism to verify proper secondary structure.

    • Limited proteolysis to assess folding quality.

These methodological considerations help overcome the challenges of expressing functional membrane-associated bacterial enzymes in heterologous systems.

How can researchers design experiments to study potential inhibitors of mtgA for antimicrobial development?

A systematic approach to studying potential mtgA inhibitors includes:

  • High-Throughput Screening Protocol:

    • Primary Assay Design:

      • Fluorescence-based transglycosylase activity assay in 384-well format.

      • Use dansyl-labeled lipid II substrates to monitor polymerization.

      • Include positive controls (moenomycin) and negative controls (DMSO).

    • Compound Libraries:

      • Natural product extracts from soil actinomycetes.

      • Chemical libraries enriched for compounds with antibiotic-like properties.

      • Rationally designed peptidomimetics based on substrate structure.

  • Structure-Activity Relationship Studies:

    • Generate compound analogs based on hit structures.

    • Establish minimum pharmacophore requirements.

    • Employ computational docking to predict binding modes.

  • Validation Assays:

    • Biochemical Confirmation:

      • Determine IC50 values using purified enzyme.

      • Assess kinetic parameters (Ki, mechanism of inhibition).

    • Cellular Assays:

      • Minimum inhibitory concentration (MIC) determination against R. meliloti.

      • Cell wall integrity assays using fluorescent D-amino acids.

      • Growth curve analysis to determine bacteriostatic vs. bactericidal effects.

  • Selectivity Assessment:

    • Test activity against human glycosyltransferases to evaluate potential toxicity.

    • Compare inhibition of mtgA from different bacterial species to assess spectrum.

  • Mode of Action Studies:

    • Direct Binding Analysis:

      • Surface plasmon resonance to measure binding kinetics.

      • Thermal shift assays to confirm target engagement.

    • Resistance Studies:

      • Generate resistant mutants and sequence mtgA to identify binding site.

      • Overexpress mtgA to confirm it as the primary target.

This experimental design provides a comprehensive framework for identifying and characterizing mtgA inhibitors with potential antimicrobial applications.

What advanced techniques can be used to study the localization and dynamics of mtgA during bacterial cell division?

Advanced techniques for studying mtgA localization and dynamics include:

  • Super-Resolution Microscopy Approaches:

    • STORM/PALM:

      • Label mtgA with photoactivatable fluorescent proteins.

      • Achieve 20-30 nm resolution to precisely map localization patterns.

      • Track dynamic changes during cell cycle progression.

    • Structured Illumination Microscopy (SIM):

      • Provides ~100 nm resolution with less photo-damage.

      • Suitable for live-cell imaging of mtgA-fluorescent protein fusions.

  • Protein-Protein Interaction Mapping:

    • Proximity Labeling:

      • APEX2 or BioID fusions to identify proteins in mtgA vicinity.

      • Mass spectrometry identification of labeled proteins.

    • Förster Resonance Energy Transfer (FRET):

      • Detect direct interactions with division proteins like FtsZ.

      • Measure nanometer-scale distances between protein pairs.

  • Live-Cell Peptidoglycan Synthesis Visualization:

    • Clickable D-amino Acid Probes:

      • Incorporate D-alanine analogues into newly synthesized peptidoglycan.

      • Perform click chemistry to visualize sites of active synthesis.

      • Correlate with mtgA localization.

  • Cryo-Electron Tomography:

    • Generate 3D reconstructions of bacterial cells.

    • Visualize macromolecular complexes in their native cellular context.

    • Combine with immunogold labeling to identify mtgA.

  • Single-Molecule Tracking:

    • Use photoactivatable fluorophores to track individual mtgA molecules.

    • Calculate diffusion coefficients and residence times.

    • Identify transition between mobile and immobile states.

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence imaging of mtgA with ultrastructural analysis.

    • Map protein localization to specific cellular structures.

These methodologies provide complementary approaches to understanding the dynamic behavior of mtgA during bacterial cell division and wall synthesis, offering insights at the single-molecule, protein complex, and whole-cell levels.

How should researchers interpret discrepancies between in vitro and in vivo studies of mtgA activity?

When confronted with discrepancies between in vitro and in vivo studies of mtgA activity, researchers should systematically evaluate several factors:

  • Biochemical Context Differences:

    • Membrane Environment: In vitro studies often use detergent-solubilized enzyme or artificial membranes that may not replicate the native lipid composition of Rhizobium meliloti membranes.

    • Interacting Partners: The cellular environment contains protein complexes and scaffolds that may regulate mtgA activity but are absent in purified systems.

    • Substrate Presentation: Natural lipid II substrates in vivo are embedded in membranes with specific organization that is difficult to replicate in vitro.

  • Methodological Approach to Reconciliation:

    • Increasingly Complex Reconstitution:

      • Begin with purified enzyme studies for baseline kinetics.

      • Add potential interacting proteins identified through proteomics.

      • Incorporate into liposomes with rhizobial membrane lipid composition.

      • Compare with permeabilized cell assays that maintain cellular architecture.

    • Genetic Approaches:

      • Create point mutations based on in vitro structure-function studies.

      • Test these mutations both in vitro and in vivo to bridge the gap.

      • Use suppressor mutation analysis to identify compensatory pathways.

  • Data Integration Framework:

    • Correlation Analysis: Plot in vitro activity measurements against in vivo phenotypic measurements for multiple mtgA variants to identify patterns.

    • Mathematical Modeling: Develop predictive models that account for differences in conditions between systems.

    • Meta-analysis: Compare results across multiple experimental platforms and research groups.

  • Common Sources of Discrepancy:

    • Post-translational modifications present only in vivo

    • Allosteric regulation by metabolites or signaling molecules

    • Differences in ion concentrations and pH between test tube and cellular environments

    • The complex tripartite genome of Rhizobium meliloti may lead to regulatory effects not captured in vitro

This systematic approach helps researchers interpret and reconcile apparently contradictory results between different experimental systems.

What are the current technical limitations in studying the interactions between mtgA and other cell wall synthesis enzymes?

Current technical limitations in studying mtgA interactions with other cell wall synthesis enzymes include:

  • Membrane Protein Complex Isolation Challenges:

    • Detergent Sensitivity:

      • Detergents required for solubilization may disrupt weak or transient interactions.

      • Different detergents yield different interaction profiles, making data interpretation difficult.

    • Complex Stability:

      • Native multiprotein complexes often dissociate during purification.

      • Time-dependent degradation affects reproducibility.

  • Methodological Limitations:

    • Co-immunoprecipitation:

      • Antibody availability for Rhizobium proteins is limited.

      • Background binding issues with membrane proteins.

    • Crosslinking Approaches:

      • Crosslinker accessibility issues in membrane environments.

      • Difficulty in distinguishing direct from proximity-based interactions.

    • Two-hybrid Systems:

      • Poor performance with membrane proteins.

      • Artificial nuclear localization in yeast systems.

  • Temporal and Spatial Resolution Constraints:

    • Live-cell Imaging:

      • Fluorescent protein fusions may affect protein function.

      • Phototoxicity limits long-term imaging.

      • Resolution limitations for closely associated proteins.

    • Single-molecule Approaches:

      • Low signal-to-noise ratio in cellular contexts.

      • Limited ability to track multiple interaction partners simultaneously.

  • Functional Assay Limitations:

    • Enzymatic Coupling:

      • Difficulty in reconstituting multi-enzyme reactions in vitro.

      • Rate-limiting steps may mask actual interaction effects.

    • Genetic Approaches:

      • Synthetic lethality of multiple mutations complicates analysis.

      • Compensatory mechanisms may mask interaction phenotypes.

  • Rhizobium-specific Challenges:

    • Limited genetic tools compared to model organisms like E. coli.

    • Complex genome structure with three separate elements complicates genetic manipulation .

    • Growth rate and culture density issues affect biochemical yields.

Addressing these limitations requires multidisciplinary approaches and technology development specifically tailored to membrane protein complexes in non-model bacterial systems.

What emerging technologies might advance our understanding of mtgA function in the context of symbiotic nitrogen fixation?

Several emerging technologies show promise for advancing our understanding of mtgA function in symbiotic nitrogen fixation:

  • Advanced Imaging Technologies:

    • Cryo-electron Tomography of Intact Nodules:

      • Visualize bacteroid ultrastructure within nodule cells.

      • Map mtgA localization in relation to the symbiosome membrane.

    • Expansion Microscopy:

      • Physically expand biological specimens to improve resolution of conventional microscopes.

      • Enable detailed visualization of peptidoglycan structure during bacteroid differentiation.

    • Correlative Light and Electron Microscopy (CLEM):

      • Combine fluorescent mtgA tracking with ultrastructural analysis.

      • Link enzyme dynamics to morphological changes during symbiosis.

  • Single-Cell and Spatial -Omics:

    • Single-Cell Transcriptomics of Nodule Bacteria:

      • Profile mtgA expression in different bacteroid developmental stages.

      • Identify co-regulated genes in the symbiotic context.

    • Spatial Transcriptomics:

      • Map gene expression patterns across nodule developmental zones.

      • Correlate mtgA expression with symbiotic efficiency markers.

    • Metaproteomics:

      • Identify protein-protein interactions specific to the symbiotic state.

  • Synthetic Biology Approaches:

    • Engineered mtgA Variants:

      • Create synthetic mtgA variants with altered activity or regulation.

      • Test the impact on symbiotic efficiency and nitrogen fixation rates.

    • Biosensors:

      • Develop fluorescent reporters for peptidoglycan synthesis activity in live cells.

      • Monitor real-time changes during symbiotic development.

  • Computational Methods:

    • Molecular Dynamics Simulations:

      • Model mtgA interactions with membranes and substrates.

      • Predict effects of mutations on enzyme function.

    • Systems Biology Models:

      • Integrate transcriptomic, proteomic, and metabolomic data.

      • Create predictive models of cell wall dynamics during symbiosis.

    • Comparative Genomics:

      • Analyze mtgA sequence and regulation across rhizobial species with different host specificities.

      • Identify correlations between mtgA variants and symbiotic fitness .

  • Genome Editing Technologies:

    • CRISPR-Cas Systems Optimized for Rhizobia:

      • Enable precise genetic manipulation with minimal off-target effects.

      • Create conditional knockdowns for essential genes like mtgA.

These emerging technologies, particularly when used in combination, offer unprecedented opportunities to understand the complex role of mtgA in the establishment and maintenance of nitrogen-fixing symbiosis.

How might research on Rhizobium meliloti mtgA contribute to developing more efficient nitrogen-fixing symbiotic relationships for sustainable agriculture?

Research on Rhizobium meliloti mtgA has significant potential to contribute to sustainable agriculture through improved symbiotic nitrogen fixation:

  • Engineering Enhanced Symbiotic Efficiency:

    • Rational Enzyme Design:

      • Modify mtgA structure to optimize peptidoglycan synthesis during symbiosis.

      • Engineer variants with improved stability under stress conditions.

    • Expression Optimization:

      • Develop strains with carefully regulated mtgA expression patterns.

      • Create promoter systems that respond to plant signals for coordinated development.

  • Extending Host Range:

    • Comparative Studies:

      • Analyze mtgA variations between rhizobial strains with different host specificities.

      • Identify peptidoglycan modifications that influence host recognition.

    • Synthetic Biology Approaches:

      • Transfer beneficial mtgA variants between rhizobial species.

      • Design chimeric enzymes incorporating domains from diverse rhizobia.

  • Improving Stress Tolerance:

    • Cellular Integrity Under Stress:

      • Develop strains with optimized cell wall properties for drought resistance.

      • Engineer mtgA variants that maintain function at elevated soil temperatures.

    • Persistence Enhancement:

      • Modify peptidoglycan structure to improve soil survival between growing seasons.

      • Optimize bacteroid longevity through cell wall modifications.

  • Data-Driven Strain Selection:

    • High-throughput Phenotyping:

      • Screen natural mtgA variants for correlation with nitrogen fixation efficiency.

      • Develop rapid assays for peptidoglycan structure and symbiotic performance.

    • Predictive Models:

      • Integrate genomic, transcriptomic, and metabolomic data to predict symbiotic efficiency.

      • Use machine learning to identify optimal mtgA characteristics for specific agricultural environments.

  • Field Application Strategies:

    • Formulation Development:

      • Create inoculant formulations that preserve optimal cell wall properties.

      • Design seed coating technologies that protect bacterial cell integrity.

    • Monitoring Tools:

      • Develop diagnostic tools to assess rhizobial cell wall health in field conditions.

      • Create biosensors to measure peptidoglycan synthesis activity in situ.

This research direction aligns with the recognized genetic complexity of rhizobia symbiotic systems, including the tripartite genome of Rhizobium meliloti with its specialized roles for different genomic elements in symbiosis . By focusing on the fundamental cell biology processes like peptidoglycan synthesis, researchers can develop more resilient and efficient nitrogen-fixing symbioses for sustainable agriculture.

What are the key knowledge gaps in our understanding of mtgA function in Rhizobium meliloti?

Despite significant advances in research on Rhizobium meliloti mtgA, several critical knowledge gaps remain:

  • Structural Characterization:

    • The three-dimensional structure of R. meliloti mtgA remains unresolved.

    • The precise substrate binding mechanism and catalytic residues are inferred from homology rather than direct evidence.

    • The membrane topology and associations with other proteins in vivo are poorly characterized.

  • Regulatory Networks:

    • The transcriptional and post-translational regulation of mtgA during symbiotic stages is incompletely understood.

    • How mtgA expression coordinates with genes on other genomic elements (pSymA and pSymB) during symbiosis remains unclear .

    • The potential role of small RNAs in modulating mtgA expression has not been investigated.

  • Functional Significance:

    • The precise contribution of mtgA to bacteroid differentiation versus other peptidoglycan synthesis enzymes is undefined.

    • Whether mtgA generates specific peptidoglycan structures unique to rhizobia is unknown.

    • The potential signaling role of peptidoglycan fragments in plant-microbe communication remains speculative.

  • Evolutionary Aspects:

    • How horizontal gene transfer may have influenced mtgA evolution across the Rhizobiaceae family is not fully explored.

    • The adaptive significance of mtgA sequence variation between strains with different host specificities requires further investigation.

  • Technology Limitations:

    • Methods for visualizing peptidoglycan synthesis in living bacteroids within nodules are underdeveloped.

    • Techniques for purifying sufficient quantities of active membrane-associated mtgA remain challenging.

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and advanced imaging techniques specifically adapted to the challenges of studying rhizobial-plant symbioses.

How should researchers prioritize future studies on mtgA to maximize both scientific understanding and practical applications?

A strategic prioritization framework for future mtgA research should balance fundamental science with application potential:

  • Immediate Research Priorities (1-3 years):

    • Structural Characterization:

      • Determine the three-dimensional structure of mtgA through crystallography or cryo-EM.

      • Identify key catalytic residues through site-directed mutagenesis.

    • Functional Genetics:

      • Develop conditional expression systems for mtgA to study its role at different symbiotic stages.

      • Create reporter strains to monitor mtgA expression during symbiosis.

    • Methodological Development:

      • Optimize protocols for purifying active mtgA while maintaining native interactions.

      • Develop high-throughput assays for mtgA activity suitable for inhibitor screening.

  • Medium-term Goals (3-5 years):

    • Systems-level Integration:

      • Map the protein-protein interaction network of mtgA in different physiological states.

      • Integrate transcriptomic and proteomic data to understand regulation across genomic elements .

    • Comparative Analysis:

      • Compare mtgA function across rhizobial species with different host ranges.

      • Identify correlations between mtgA sequence variants and symbiotic efficiency.

    • Translational Research:

      • Screen for mtgA variants with enhanced stability or activity under agricultural conditions.

      • Develop pilot-scale field trials with optimized rhizobial strains.

  • Long-term Directions (5+ years):

    • Synthetic Biology Applications:

      • Engineer rhizobia with designer mtgA variants for specific agricultural environments.

      • Develop synthetic pathways for novel peptidoglycan structures that enhance symbiosis.

    • Expanded Host Range:

      • Extend nitrogen fixation capabilities to non-legume crops through mtgA engineering.

      • Create rhizobial strains with broader host compatibility.

    • Climate Resilience:

      • Develop strains with mtgA variants adapted to function under climate change scenarios.

      • Engineer peptidoglycan structures that protect bacteria from environmental stresses.

  • Cross-cutting Themes:

    • Collaborative Frameworks:

      • Establish research consortia combining expertise in structural biology, microbiology, and plant science.

      • Develop partnerships between academic researchers and agricultural biotechnology companies.

    • Technology Development:

      • Invest in advanced imaging techniques for studying peptidoglycan in symbiotic contexts.

      • Create bioinformatic tools specific to rhizobial genomics and proteomics.

    • Training and Resources:

      • Develop standardized protocols and resources for mtgA research.

      • Train next-generation researchers in interdisciplinary approaches to symbiosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.