Recombinant Rhizobium meliloti NADH-quinone oxidoreductase subunit A 1 (nuoA1)

Shipped with Ice Packs
In Stock

Description

Structure and Composition

NDH-1 is a large multi-subunit enzyme complex. The bacterial NDH-1, found in organisms like Paracoccus denitrificans and Thermus thermophilus, consists of 14 subunits . The mitochondrial enzyme in mammals contains over 40 subunits . In Paracoccus denitrificans, the NDH-1 complex comprises at least 14 subunits (NQO1-14) .

Function and Mechanism

NDH-1 catalyzes the transfer of electrons from NADH to the quinone pool in the cytoplasmic membrane . This process is coupled with the generation of a proton electrochemical gradient . The enzyme works with almost equal efficiency with the cofactors NADH and NADPH . During catalysis, a tightly bound FAD cofactor is reduced by NAD(P)H in the first stage of a substituted enzyme mechanism .

NuoA1 Subunit

The NuoA1 subunit is a component of the NDH-1 complex. Research indicates that the PSST subunit, homologous to NQO6 in bacteria, plays a crucial role in electron transfer by functionally coupling iron-sulfur cluster N2 to quinone .

Quinone Oxidoreductase

NAD(P)H quinone oxidoreductase 1 (NQO1) is an intracellular, cytosolic enzyme that catalyzes the reduction of quinones and a variety of other compounds . NQO1 is a homodimer with two active sites located at the interface between the subunits .

Inhibitors

Dicoumarol is a potent inhibitor of NQO1 . Other inhibitors of NDH-1 include rotenone, piericidin A, bullatacin, and pyridaben .

Role in Disease

Dysfunction of mitochondrial proton-translocating NADH-ubiquinone oxidoreductase (complex I) is associated with neurodegenerative disorders, such as Parkinson's disease and Huntington's disease . NQO1 is often over-expressed in cancer cells and is considered a possible drug target .

Resistance to Complex I Inhibition

Expression of the single-subunit NADH dehydrogenase of Saccharomyces cerevisiae (Ndi1P) can render mammalian nerve cells resistant to complex I inhibitors .

Rhizobium meliloti

Rhizobium meliloti is a bacterium known for its symbiotic relationship with legume roots, facilitating the development of nitrogen-fixing nodules . Rhizobium bacteria synthesize N-acylated beta-1,4-N-acetylglucosamine lipooligosaccharides, called Nod factors, which act as morphogenic signal molecules to legume roots during development of nitrogen-fixing nodules .

Tables

Table 1: Stoichiometry of Peripheral Subunits of P. denitrificans NDH-1

SubunitStoichiometry
NQO11
NQO21
NQO31
NQO41
NQO51
NQO91

Table 2: Partition Ratios for Inhibition of NQO1 by Indolequinones

CompoundPartition Ratio
5High
16High
24High
8Not Determined
20Not Determined
27Near 1
12Near 1
28Near 1
13Near 1
29Near 1
14Near 1

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA1; nuoA; R01264; SMc01912; NADH-quinone oxidoreductase subunit A 1; NADH dehydrogenase I subunit A 1; NDH-1 subunit A 1; NUO1 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
nuoA1
Target Protein Sequence
MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD VRFYLVSILFIIFDLEVAFLFPWAVSFKEMGWFGFWSMMVFLLVLTVGFIYEWKKGALEW N
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.