Recombinant Rhizobium meliloti NADH-quinone oxidoreductase subunit K 1 (nuoK1)

What is the structure and function of nuoK1 in Rhizobium meliloti?

The nuoK1 protein is a membrane-embedded subunit of the NADH-quinone oxidoreductase complex (Complex I) in Rhizobium meliloti. According to protein data, the full-length protein consists of 102 amino acids with the sequence: MEIGISHYLTVSAILFTLGVFGIFLNRKNVIIILMSVELILLAVNINMVAFSAFLNDITGQVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG . The amino acid composition suggests multiple transmembrane helices, consistent with its role in the membrane domain of Complex I. This hydrophobic profile is typical for subunits involved in proton translocation across the bacterial membrane.

In the electron transport chain, nuoK1 likely contributes to the proton-pumping function of Complex I. The process begins with NADH oxidation by the peripheral arm of the complex, followed by electron transfer through iron-sulfur clusters to the quinone binding site. This electron transfer couples with proton translocation across the membrane, involving membrane subunits like nuoK1, generating the proton gradient necessary for ATP synthesis via ATP synthase.

The protein may perform specialized functions in R. meliloti during its symbiotic nitrogen fixation with alfalfa (Medicago sativa), where energy demands are particularly high for supporting nitrogenase activity.

How does nuoK1 expression differ in free-living versus symbiotic states?

While the search results don't provide direct comparative data on nuoK1 expression across different physiological states, research on R. meliloti gene regulation suggests significant differences likely exist. R. meliloti has separate regulatory pathways for activating gene expression in free-living conditions versus during symbiotic nitrogen fixation . This regulatory distinction, documented for nif genes, likely extends to respiratory chain components like nuoK1.

In free-living conditions, nuoK1 would function within a conventional respiratory chain, with electrons flowing from various carbon sources through NADH to the quinone pool and ultimately to terminal oxidases. During symbiosis, several factors would influence its expression:

• The microaerobic environment inside root nodules likely alters respiratory chain regulation

• The carbon source shifts to plant-derived C4-dicarboxylates

• The high ATP demand for nitrogen fixation requires efficient energy conservation

Researchers investigating these differences should employ comparative transcriptomics or proteomics across growth conditions, combined with functional studies examining respiratory chain activity in both states.

What are the optimal conditions for expressing recombinant nuoK1 protein?

Successful expression of recombinant nuoK1 has been achieved in E. coli systems with an N-terminal His-tag . Based on this information and considering the membrane-embedded nature of the protein, researchers should optimize several parameters:

Expression System Selection:

Optimization Parameters:

• Induction conditions: Low temperature (16-20°C) often improves membrane protein folding

• Inducer concentration: Lower IPTG concentrations (0.1-0.5 mM) may reduce aggregation

• Media composition: Addition of glycerol (0.5-1%) can enhance membrane protein expression

• Membrane extraction: Gentle detergent solubilization (DDM, LMNG) at 4°C

For storage, the recombinant protein should be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, and repeated freeze-thaw cycles should be avoided to maintain protein integrity.

How should researchers verify the integrity and activity of purified nuoK1?

Verifying the structural integrity and functional activity of membrane proteins like nuoK1 requires a multi-faceted approach:

Structural Integrity Assessment:

• SDS-PAGE with Coomassie staining to confirm purity and expected molecular weight

• Western blot analysis using anti-His antibodies to verify protein identity

• Circular dichroism (CD) spectroscopy to assess secondary structure content

• Size exclusion chromatography to evaluate monodispersity and oligomeric state

Functional Analysis:

• Reconstitution into proteoliposomes to create a functional membrane environment

• NADH:ubiquinone oxidoreductase activity assays measuring NADH oxidation rates

• Proton pumping assays using pH-sensitive fluorescent dyes

• Electron transfer measurements with artificial electron acceptors

Interaction Studies:

• Pull-down assays to verify interaction with other Complex I subunits

• Crosslinking experiments to identify neighboring proteins in the complex

• Complementation assays in nuoK1-deficient strains to assess functional rescue

For definitive validation, researchers should demonstrate that the recombinant protein can functionally replace the native protein in appropriate assay systems, ideally showing restoration of Complex I activity in a nuoK1 deletion strain of R. meliloti.

What mutagenesis strategies are most effective for studying nuoK1 function?

When designing mutagenesis experiments for nuoK1, researchers should employ targeted approaches that consider both the membrane topology and functional domains of the protein:

Guided Mutagenesis Approaches:

• Alanine scanning: Systematically replace residues with alanine to identify essential amino acids while minimizing structural disruption

• Charge reversal mutations: Target charged residues that may participate in proton translocation

• Conservation-guided mutagenesis: Prioritize highly conserved residues across bacterial species, which likely play critical functional roles

• Cysteine scanning: Replace selected residues with cysteine for subsequent labeling with fluorescent or spin probes

High-throughput Strategies:
Transposon mutagenesis approaches, as described for Rhizobium studies, can provide complementary insights into gene function . This Tn-seq methodology involves:

• Generation of a library of mutant clones with random transposon insertions

• Culturing the pooled library under defined environmental challenges

• Deep sequencing to identify insertion locations and frequencies

• Analysis of under/over-represented insertions as indicators of fitness effects

Phenotypic Analysis:
For each mutation, researchers should assess:

• Complex I assembly via blue native PAGE

• NADH oxidation activity in membrane preparations

• Growth characteristics under different respiratory conditions

• Symbiotic performance with host plants

• Proton-pumping efficiency in reconstituted systems

This multi-tiered approach will help distinguish mutations affecting protein stability, complex assembly, or specific catalytic functions, providing a comprehensive understanding of nuoK1's role in R. meliloti physiology.

How can researchers purify functional recombinant nuoK1 protein?

Purification of membrane proteins like nuoK1 requires specialized approaches to maintain structural integrity and function. Based on successful expression of His-tagged nuoK1 , the following protocol is recommended:

1. Cell Lysis and Membrane Preparation:

• Harvest E. coli cells expressing nuoK1 by centrifugation

• Resuspend in buffer containing protease inhibitors

• Disrupt cells using sonication or high-pressure homogenization

• Remove unbroken cells and debris by low-speed centrifugation (10,000 × g, 20 min)

• Collect membranes by ultracentrifugation (100,000 × g, 1 hour)

• Wash membrane pellet to remove peripheral proteins

2. Membrane Protein Solubilization:

• Resuspend membrane pellet in solubilization buffer containing:

  • Gentle detergent (DDM at 1% or LMNG at 0.5-1%)

  • 150-300 mM NaCl

  • 50 mM Tris-HCl or phosphate buffer, pH 7.4-8.0

  • Glycerol (10-20%)

  • Protease inhibitors

• Incubate with gentle agitation (2-4 hours or overnight at 4°C)

• Remove insoluble material by ultracentrifugation

3. Affinity Purification:

• Apply solubilized proteins to Ni-NTA or TALON resin

• Wash with increasing imidazole concentrations (10-40 mM)

• Elute with high imidazole (200-300 mM)

• Buffer exchange to remove imidazole

4. Additional Purification Steps:

• Size exclusion chromatography to remove aggregates

• Optional ion exchange chromatography for further purification

5. Quality Control:

• Assess purity by SDS-PAGE (>90% purity expected)

• Verify identity by Western blot and/or mass spectrometry

• Evaluate protein stability by thermal shift assay

6. Storage:

• Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Add glycerol to 5-50% final concentration

• Flash-freeze in liquid nitrogen and store at -80°C in small aliquots

Throughout the purification process, it's critical to maintain a stable detergent concentration above the critical micelle concentration to prevent protein aggregation.

What techniques are most valuable for studying nuoK1 interactions with other Complex I subunits?

Understanding the interactions between nuoK1 and other Complex I components requires techniques that can capture membrane protein interactions while maintaining their native structure:

In vitro Interaction Analysis:

• Co-purification studies: Express nuoK1 with affinity tags and identify co-purifying partners by mass spectrometry

• Crosslinking mass spectrometry: Use chemical crosslinkers to capture transient interactions followed by MS/MS analysis to identify interaction sites

• Surface plasmon resonance (SPR): Measure binding kinetics between purified nuoK1 and potential partner proteins

• Microscale thermophoresis: Detect interactions based on changes in thermophoretic mobility upon binding

Structural Approaches:

• Cryo-electron microscopy: Resolve the structure of intact Complex I with nuoK1 in position

• NMR studies: Investigate specific interactions using isotopically labeled domains

• Computational modeling: Use homology modeling based on related bacterial Complex I structures to predict interaction interfaces

Genetic and In vivo Approaches:

• Bacterial two-hybrid assays: Adapted for membrane proteins to detect protein-protein interactions

• Suppressor mutation analysis: Identify second-site mutations that compensate for nuoK1 defects

• Tn-seq interaction mapping: Use transposon mutagenesis to identify genetic interactions as described in R. meliloti research

Functional Validation:

• Complementation assays: Test whether mutant phenotypes can be rescued by wild-type or modified proteins

• Activity assays: Measure how interactions affect Complex I function

• In vivo crosslinking: Capture interactions in living cells

The integration of data from multiple approaches is essential, as each technique has inherent limitations when applied to membrane protein complexes.

How can researchers assess the impact of nuoK1 mutations on Complex I assembly?

Evaluating how mutations in nuoK1 affect the assembly of the entire NADH-quinone oxidoreductase complex requires a systematic approach combining biochemical, biophysical, and genetic techniques:

Biochemical Analysis:

• Blue Native PAGE: Separate intact complexes from assembly intermediates

  • Compare migration patterns between wild-type and mutant strains

  • Use in-gel activity staining to assess functional assembly

• Sucrose gradient ultracentrifugation: Separate complexes based on size and shape

• Quantitative proteomic analysis: Measure stoichiometry of Complex I subunits in purified preparations

Structural Assessment:

• Electron microscopy: Visualize complex architecture with negative staining or cryo-EM

• Limited proteolysis: Probe structural changes in the complex due to mutations

• Hydrogen-deuterium exchange mass spectrometry: Identify regions with altered solvent accessibility

Expression and Stability Analysis:

• Pulse-chase experiments: Track the kinetics of complex assembly and turnover

• Protein half-life determination: Measure stability of assembled complexes

• Subunit quantification: Assess changes in steady-state levels of complex components

Genetic Approaches:

• Synthetic lethality screening: Identify genetic interactions that affect assembly

• Tn-seq analysis: Apply transposon mutagenesis to identify suppressor mutations

• Complementation assays: Test different nuoK1 variants for ability to rescue assembly defects

When interpreting results, researchers should consider that R. meliloti has a multipartite genome with potential genetic interactions between chromosomal genes (like nuoK1) and genes on accessory replicons (pSymA/pSymB), as demonstrated in studies of gene essentiality . These genomic interactions may influence complex assembly in ways that differ from model organisms with single chromosomes.

What is the role of nuoK1 in R. meliloti nitrogen fixation and plant symbiosis?

While the search results don't directly address nuoK1's specific role in symbiosis, we can infer its importance based on the energetics of nitrogen fixation and R. meliloti biology:

Energy Requirements in Symbiosis:

• Nitrogen fixation (N₂ + 8H⁺ + 8e⁻ + 16ATP → 2NH₃ + H₂ + 16ADP + 16Pi) demands substantial energy input

• Efficient electron transport chain operation, including NADH-quinone oxidoreductase containing nuoK1, is critical for generating the proton motive force needed for ATP synthesis

• Under the microaerobic conditions of root nodules, efficient energy conservation becomes even more crucial

Potential Specialized Functions:

• Complex I may operate differently in bacteroids compared to free-living cells

• As demonstrated with ntrC genes, R. meliloti has separate regulatory pathways for activating gene expression during symbiotic nitrogen fixation versus free-living conditions

• The nutritional environment within nodules differs significantly from rhizosphere conditions, potentially affecting electron transport chain operation

Research Approaches to Determine nuoK1's Symbiotic Role:

• Create precise nuoK1 deletion or point mutants and assess:

  • Nodulation efficiency

  • Nitrogenase activity in bacteroids

  • Plant growth parameters

  • Bacteroid ultrastructure

• Compare transcription and translation of nuoK1 between free-living and symbiotic states

• Perform in vivo metabolic labeling to assess energy metabolism in wild-type versus nuoK1 mutant bacteroids

Understanding nuoK1's symbiotic role would enhance our knowledge of how bacterial respiration adapts to support the energy-intensive process of biological nitrogen fixation, potentially informing strategies to improve symbiotic efficiency.

How does the genomic context of nuoK1 influence its function and evolution?

Rhizobium meliloti possesses a multipartite genome consisting of a chromosome and secondary replicons (pSymA and pSymB), which creates a complex genomic context that influences gene function and evolution . For nuoK1, this genomic architecture has several important implications:

Genomic Organization and Expression:

• The presence of nuoK1 on the main chromosome suggests it is part of the core genome rather than accessory functions often encoded on secondary replicons

• The chromosomal location may indicate evolutionary conservation and integration with central metabolic processes

• Regulatory elements controlling nuoK1 expression may interact with factors encoded on secondary replicons

Evolutionary Considerations:

• The designation "nuoK1" suggests potential gene duplication or paralog presence, possibly distributed across different replicons

• Comparative genomics across Rhizobiales could reveal whether nuoK has undergone specialized evolution in nitrogen-fixing symbionts

• Synteny analysis would indicate whether the gene order of Complex I components is conserved, suggesting co-evolution of the respiratory complex

Genetic Interactions:
Studies on R. meliloti have demonstrated that genes on the chromosome can have significant genetic interactions with elements on pSymA and pSymB . This suggests:

• nuoK1 function may depend on factors encoded on secondary replicons

• Phenotypes of nuoK1 mutations might differ between wild-type R. meliloti and derivatives lacking pSymA/pSymB

• The fitness contribution of nuoK1 could be condition-dependent based on these interactions

Research Approaches:

• Compare nuoK1 function in wild-type R. meliloti versus single-replicon derivatives

• Use Tn-seq methodology to identify genetic interactions between nuoK1 and other genomic regions

• Analyze the evolutionary rate of nuoK1 compared to its homologs in related bacteria with different genome architectures

Understanding these genomic context effects is crucial for fully characterizing nuoK1 function and could reveal how multipartite genomes influence the evolution of core metabolic components.

What structural features of nuoK1 contribute to proton translocation in Complex I?

Analysis of the nuoK1 amino acid sequence (MEIGISHYLTVSAILFTLGVFGIFLNRKNVIIILMSVELILLAVNINMVAFSAFLNDITGQVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG) reveals structural features likely important for its role in proton translocation:

Transmembrane Topology:

• Hydrophobicity analysis suggests multiple transmembrane helices spanning the membrane

• These transmembrane segments likely form part of the proton translocation pathway

• Positively charged residues (K, R) positioned at potential membrane interfaces follow the "positive inside rule" for membrane protein topology

Functional Domains:

• Conserved residues across species would identify amino acids crucial for function (requiring comparative analysis)

• Charged residues within transmembrane regions often participate directly in proton transfer

• Polar residues forming hydrogen-bond networks can create proton-conducting pathways

Structural Flexibility:

• Glycine residues provide flexibility in transmembrane helices

• This flexibility may facilitate conformational changes during the catalytic cycle

• The coordinated movement of transmembrane helices is essential for coupling electron transfer to proton pumping

Interaction Surfaces:

• Specific faces of transmembrane helices likely form interaction surfaces with other membrane subunits

• These interactions stabilize the complex and may form part of the proton translocation pathway

• The relatively small size of nuoK1 (102 amino acids) suggests it serves as a structural connector between larger subunits

Research Approaches to Characterize These Features:

• Site-directed mutagenesis targeting conserved or charged residues

• Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

• Molecular dynamics simulations to model proton movement through the protein

• Homology modeling based on related bacterial Complex I structures with solved crystal structures

Understanding these structural features would provide insights into how electron transfer in the peripheral arm of Complex I drives proton translocation through membrane subunits like nuoK1.

How can researchers integrate nuoK1 data into genome-scale metabolic models of R. meliloti?

Integrating nuoK1-specific data into genome-scale metabolic models requires sophisticated approaches that capture both the protein's specific function and its context within R. meliloti metabolism:

Model Development Strategy:

• Representation of Complex I:

  • Include reactions representing NADH oxidation coupled to proton translocation

  • Define stoichiometry of proton translocation per NADH oxidized

  • Incorporate thermodynamic constraints based on experimental data

• Integration with Experimental Data:

  • Tn-seq approaches for determining gene essentiality provide valuable constraints

  • If nuoK1 is essential under certain conditions, the model should require non-zero flux through Complex I reactions

  • Growth measurements with various carbon sources can validate model predictions

• Multi-replicon Considerations:

  • Account for genetic interactions between nuoK1 and genes on pSymA/pSymB

  • Compare model predictions between wild-type and single-replicon derivatives

  • Incorporate regulatory interactions spanning different replicons

Methodological Framework:
A Tn-seq-guided reconstruction process has been demonstrated for R. meliloti, showing how "integration of Tn-seq data with in silico metabolic modeling...overcomes the limitations of using either of these approaches in isolation to develop a consolidated view of the core metabolism of the organism" . This approach:

• Uses transposon insertion density to identify essential and non-essential genes

• Refines metabolic models based on these essentiality constraints

• Produces models that better predict growth phenotypes

Condition-Specific Modeling:

• Develop separate model configurations for free-living versus symbiotic states

• Incorporate gene expression data to constrain fluxes in different conditions

• Account for differences in carbon source utilization between free-living growth and bacteroid metabolism

Validation Strategy:

• Compare model predictions with measured growth rates, respiration rates, and ATP production

• Perform sensitivity analysis to identify key parameters affecting model predictions

• Test model predictions with nuoK1 mutants or variants with altered activity

This integrative approach would provide a systems-level understanding of nuoK1's contribution to R. meliloti metabolism in both free-living and symbiotic states.

What statistical approaches should be used for analyzing nuoK1 mutant phenotypes?

Robust statistical analysis is essential for accurately interpreting phenotypic data from nuoK1 mutants. Based on methodologies described for R. meliloti research, the following approaches are recommended:

For Tn-seq Data Analysis:

• Normalize insertion counts to account for sequencing depth differences

• Apply statistical tests to identify significantly depleted insertion sites

• Calculate fitness scores based on insertion frequency changes

• Implement Bayesian approaches to estimate gene essentiality probabilities

As noted in R. meliloti research: "A strong correlation was observed between the number of insertions per gene in each set of duplicates, indicating high reproducibility of the results and that differences between conditions were unlikely to reflect random fluctuations" . This emphasizes the importance of replication and correlation analysis.

For Growth Phenotype Analysis:

• Fit growth curves with parametric models (e.g., Gompertz function)

• Use mixed-effects models to account for experimental batch effects

• Apply ANOVA or t-tests for comparing growth parameters across conditions

• Implement time-series analysis for dynamic growth responses

For Multivariate Phenotypic Data:

• Principal Component Analysis (PCA) to identify major sources of variation

• Hierarchical clustering to group similar phenotypes

• MANOVA for simultaneous comparison of multiple dependent variables

• Machine learning approaches to identify patterns in complex phenotypic data

For Genetic Interaction Studies:

• Calculate genetic interaction scores for double mutants

• Develop network analysis to map interaction landscapes

• Perform enrichment analysis to identify functional categories with significant interactions

Methodological Considerations:

When analyzing nuoK1 mutant phenotypes, researchers should consider that effects may differ between growth conditions and genetic backgrounds, particularly given R. meliloti's multipartite genome and the genetic interactions between chromosomal genes and secondary replicons .

How should researchers interpret conflicting results regarding nuoK1 function?

When confronted with apparently contradictory results regarding nuoK1 function, researchers should consider several factors that might explain the discrepancies:

Experimental Context Differences:

• R. meliloti has separate regulatory pathways for gene expression in different conditions

• Results from free-living versus symbiotic states may naturally differ

• Growth media composition can significantly affect phenotypes (as demonstrated with biotin supplementation in R. meliloti)

• The precise microaerobic conditions used for experiments may affect respiratory chain function

Genetic Background Variations:

• Studies have demonstrated interactions between chromosomal genes and secondary replicons in R. meliloti

• Different laboratory strains may contain subtle genetic differences

• The presence or absence of pSymA and pSymB replicons would significantly affect results

• Spontaneous suppressor mutations might arise during experiments with essential components

Methodological Factors:

• Expression level differences between studies can affect outcomes

• Purification methods may affect protein stability or activity

• The specific assays used to measure function may capture different aspects of nuoK1 activity

• Different detergents used for membrane protein solubilization can alter protein conformation

Resolution Strategies:

• Perform side-by-side comparisons under identical conditions

• Develop comprehensive models that can accommodate seemingly contradictory observations

• Consider whether results reflect different aspects of a complex function rather than true contradictions

• Design experiments that can directly test competing hypotheses

What bioinformatic approaches are most valuable for analyzing nuoK1 conservation across bacterial species?

Understanding the evolutionary conservation of nuoK1 requires sophisticated bioinformatic approaches that can reveal patterns across diverse bacterial species:

Sequence Analysis Pipeline:

• Homology Identification:

  • BLAST/PSI-BLAST searches against diverse bacterial genomes

  • HMM-based searches using profile hidden Markov models

  • Careful filtering to distinguish true homologs from paralogs

• Multiple Sequence Alignment:

  • Specialized algorithms for membrane proteins (e.g., PRALINE)

  • Manual curation focusing on transmembrane regions

  • Position-specific scoring matrix generation

• Evolutionary Analysis:

  • Phylogenetic tree construction using maximum likelihood methods

  • Calculation of selection pressures (dN/dS ratios) to identify constrained regions

  • Identification of co-evolving residues that might be functionally linked

  • Ancestral sequence reconstruction to track evolutionary changes

Structural Bioinformatics:

• Homology modeling based on related bacterial Complex I structures

• Mapping of conservation scores onto structural models

• Prediction of protein-protein interaction interfaces

• Analysis of lipid-protein interactions in membrane environment

Genomic Context Analysis:
R. meliloti has a multipartite genome with a chromosome and secondary replicons (pSymA/pSymB) , making genomic context particularly informative:

• Examination of nuoK1 gene neighborhood across species

• Assessment of gene synteny conservation

• Analysis of potential operon structures

• Identification of regulatory elements in promoter regions

R. meliloti-Specific Considerations:

• Search for potential paralogs on different replicons

• Comparative genomics across Rhizobiales to understand symbiosis-specific adaptations

• Integration with Tn-seq data to understand fitness contributions in different contexts

This comprehensive bioinformatic approach would reveal which aspects of nuoK1 structure and function are most highly conserved, providing insights into the protein's essential features and potential adaptations in nitrogen-fixing symbionts.

How can researchers develop a comprehensive experimental workflow for nuoK1 characterization?

A systematic experimental workflow for characterizing nuoK1 should progress from basic characterization to advanced functional studies:

Phase 1: Preliminary Characterization

• Genetic Analysis:

  • Create precise deletion mutants using homologous recombination

  • Develop complementation systems with controlled expression

  • Apply Tn-seq methodology to identify genetic interactions

• Expression Profiling:

  • Quantify transcription and translation under various conditions

  • Compare expression between free-living and symbiotic states

  • Identify regulatory factors controlling nuoK1 expression

• Preliminary Phenotyping:

  • Growth curve analysis under different respiratory conditions

  • Assessment of symbiotic performance with host plants

  • Measurement of membrane potential and ATP production

Phase 2: Biochemical Characterization

• Protein Expression and Purification:

  • Optimize heterologous expression in E. coli systems

  • Develop purification protocols maintaining protein stability

  • Verify purity and integrity through multiple analytical methods

• Structural Studies:

  • Membrane topology mapping

  • Identification of protein-protein interactions within Complex I

  • Incorporation into structural biology pipelines (cryo-EM, X-ray crystallography)

• Functional Reconstitution:

  • Development of in vitro activity assays

  • Proteoliposome reconstitution for proton pumping measurements

  • Electron transfer kinetics measurements

Phase 3: Advanced Functional Analysis

• Site-Directed Mutagenesis:

  • Systematic mutagenesis of conserved residues

  • Creation of reporter constructs for localization studies

  • Development of suppressor screens to identify functional partners

• Physiological Integration:

  • Metabolic flux analysis in wild-type versus mutant strains

  • Real-time bioenergetic measurements during symbiosis

  • Integration with genome-scale metabolic models

• Systems Biology Approaches:

  • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

  • Network analysis to position nuoK1 in broader cellular processes

  • Mathematical modeling of electron transport and energy conservation

This comprehensive workflow would provide a holistic understanding of nuoK1's role in R. meliloti physiology across different growth conditions and developmental states, establishing connections between its molecular function and ecological significance.