Recombinant Rhizobium meliloti Nitrogen fixation protein fixH (fixH)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhizobium meliloti Nitrogen Fixation Protein FixH (FixH)

Rhizobium meliloti nitrogen fixation protein FixH (FixH) is a protein involved in the nitrogen fixation process in the bacterium Rhizobium meliloti, now known as Sinorhizobium meliloti . S. meliloti establishes a symbiotic relationship with leguminous plants like alfalfa, where it resides in root nodules and converts atmospheric nitrogen into a form usable by the plant .

Function and Role of FixH

While the provided documents do not explicitly detail the function of FixH, they do provide information regarding the broader context of nitrogen fixation and related proteins:

  • Nitrogen Fixation Genes: The expression of nitrogen fixation (nif and fix) genes in Rhizobium meliloti is triggered by a reduction in oxygen levels .

  • FixL and FixJ: FixL and FixJ are two proteins essential for sensing and transmitting the low-oxygen signal required for nitrogen fixation . FixL, an oxygen sensor, is a membrane protein that possesses kinase activity . Under low oxygen conditions, FixL autophosphorylates and transfers the phosphate to FixJ, which, in turn, activates nifA and fixK promoters .

  • NifA: NifA is a crucial activator of nitrogen fixation genes, including fixABCX, nifN, and nifB, as well as the nifHDK operon that encodes the subunits of the nitrogenase enzyme responsible for nitrogen reduction .

  • BacA: The bacA gene is essential for nodule development in the S. meliloti-alfalfa symbiosis. Mutants lacking bacA lyse and die after being released from infection threads into plant membrane-bound compartments .

Experimental Data and Research Findings

Although specific data tables and research findings for Recombinant Rhizobium meliloti Nitrogen fixation protein fixH (fixH) are absent, research has provided insight into FixL:

  • A fragment of FixL, from amino acid residue 127 to residue 260, binds heme, retains the ability to bind oxygen, and has no detectable kinase activity .

  • A C-terminal fragment of FixL, beginning at residue 260, fails to bind heme but is active as a kinase .

  • Anaerobiosis enhances FixL* autophosphorylation and FixJ phosphorylation activities in vitro .

  • The heme-binding region of FixL is required in vitro for oxygen regulation of its kinase activities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
fixH; RA0660; SMa1210; Nitrogen fixation protein FixH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
fixH
Target Protein Sequence
MSTATKQRSPKRGFTGWHMVAVMSLFFGTVISVNLVMAWNASRSWSGLVVENTYVASQQF NGKVAEGRAFQASGIKGRLTTEPGAIRYVLTRNGEPEQKIDKVIAVLKRPVEEHEDLRVE LHPRGEGAFVLAEELKPGQWIAAMMAMAGDAVVHRQTIRFIAEGRDK
Uniprot No.

Target Background

Function

FixG, FixH, FixI, and FixS proteins may be components of a membrane-bound complex that couples the FixI cation pump to a redox process catalyzed by FixG.

Database Links

KEGG: sme:SMa1210

Subcellular Location
Cell membrane.

Q&A

How does FixH contribute to the nitrogen fixation process in Rhizobium meliloti?

FixH is part of the fix gene cluster that plays a crucial role in symbiotic nitrogen fixation in Rhizobium meliloti. The protein functions within a complex regulatory network that enables the bacterium to fix atmospheric nitrogen in low-oxygen environments, particularly within root nodules of leguminous plants like alfalfa.

FixH works in conjunction with other Fix proteins in a pathway that is regulated primarily in response to oxygen concentration . While the exact biochemical function of FixH is still being investigated, it is understood to be essential for proper nitrogen fixation during symbiosis. FixH is expressed under microaerobic conditions, which mimic the low-oxygen environment of root nodules where nitrogen fixation occurs .

Research has shown that the expression of fix genes, including fixH, is controlled by regulatory systems including the FixL-FixJ two-component system and the hFixL-FxkR system in some strains . These systems sense oxygen levels and trigger appropriate gene expression for nitrogen fixation when conditions are favorable.

What are the established protocols for expressing recombinant Rhizobium meliloti FixH protein?

The expression of recombinant Rhizobium meliloti FixH protein typically follows these methodological steps:

  • Vector Selection: The fixH gene is commonly cloned into expression vectors containing a His-tag for purification purposes. Plasmids with inducible promoters like T7 are often used .

  • Host Selection: E. coli is the predominant host for expression due to its well-characterized genetics and rapid growth. Strains like BL21(DE3) are frequently employed for protein expression .

  • Induction Protocol:

    • Grow E. coli culture to mid-log phase (OD600 of 0.6-0.8)

    • Induce expression with IPTG (typically 0.5-1.0 mM)

    • Incubate at lower temperatures (16-25°C) for 4-16 hours to enhance soluble protein production

  • Purification Strategy:

    • Lyse cells using sonication or pressure-based methods

    • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Elute with imidazole gradient (typically 50-250 mM)

    • Further purify using size exclusion chromatography if needed

  • Storage Conditions: The purified protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, adding glycerol (to a final concentration of 5-50%) and storing at -20°C/-80°C is recommended .

How can researchers measure the functional activity of recombinant FixH protein?

Assessing the functional activity of recombinant FixH protein involves several complementary approaches:

  • Biochemical Assays:

    • Protein-protein interaction studies using pull-down assays or co-immunoprecipitation to identify binding partners within the nitrogen fixation pathway

    • Analysis of membrane association using fractionation techniques, as FixH is predicted to be membrane-associated

  • Genetic Complementation:

    • Transform fixH mutant strains with the recombinant fixH gene to assess restoration of function

    • Measure nitrogen fixation rates using acetylene reduction assays in complemented strains

    • Analyze plant growth parameters in symbiosis experiments with complemented bacteria

  • Expression Studies:

    • Use translational fusions to reporter genes (such as lacZ) to measure expression under different conditions

    • Compare expression in free-living microaerobic conditions versus symbiotic conditions

    • Analyze the effects of regulatory mutations (in fixL, fixJ, fixK) on fixH expression

  • Oxygen-Response Testing:

    • Monitor protein activity under varying oxygen concentrations to assess oxygen sensitivity

    • Use microaerobic chambers to create controlled low-oxygen environments that mimic nodule conditions

  • Symbiotic Performance Analysis:

    • Inoculate host plants (typically alfalfa for Rhizobium meliloti) with strains expressing wild-type or mutant fixH

    • Evaluate nodule formation, nitrogen fixation rates, and plant growth parameters

How is fixH expression regulated in response to environmental conditions?

The regulation of fixH expression in Rhizobium meliloti involves sophisticated oxygen-sensing and nitrogen-response mechanisms:

What are the interactions between FixH and other proteins in the nitrogen fixation pathway?

FixH functions within a complex network of protein interactions in the nitrogen fixation pathway:

  • Interactions with Membrane Proteins:

    • FixH is predicted to be membrane-associated and likely interacts with other membrane components of the respiratory and electron transport chain

    • These interactions are crucial for energy provision to the nitrogenase complex under microaerobic conditions

  • Regulatory Protein Interactions:

    • FixH expression is influenced by interactions between regulatory proteins like FixJ, FixK, and NifA

    • These regulatory proteins form a cascade that ensures proper timing and levels of fixH expression

  • Experimental Approaches to Study Interactions:

    • Yeast two-hybrid systems or bacterial two-hybrid systems to identify direct protein-protein interactions

    • Co-immunoprecipitation followed by mass spectrometry to identify protein complexes containing FixH

    • Cross-linking studies to capture transient interactions in vivo

    • Fluorescence resonance energy transfer (FRET) to study interactions in live cells

  • Functional Complexes:

    • FixH may function in coordination with FixI, FixG, and FixN proteins

    • These proteins together form functional complexes involved in electron transport and energy provision for nitrogen fixation

How can heterologous expression systems be optimized for studying FixH function?

Optimizing heterologous expression systems for FixH requires addressing several challenges:

  • Codon Optimization Strategies:

    • Analyze codon usage bias between Rhizobium meliloti and expression hosts

    • Synthesize codon-optimized genes for improved expression in E. coli or other hosts

    • Consider using specialized E. coli strains that supply rare tRNAs for problematic codons

  • Managing Membrane Protein Expression:

    • Since FixH appears to be membrane-associated, consider using specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Test different induction temperatures (typically lowering to 16-20°C) to improve proper folding

    • Use mild detergents for extraction and purification to maintain protein integrity

  • Expression System Selection:

    • Compare expression levels and protein functionality in different hosts:

      • E. coli for high-yield production

      • Yeast systems for eukaryotic-like post-translational modifications

      • Cell-free systems for difficult-to-express proteins

    • Consider using homologous expression in related Rhizobium species for more native-like protein production

  • Fusion Partners and Solubility Tags:

    • Test various fusion partners (MBP, SUMO, GST) to enhance solubility

    • Use cleavable tags that can be removed after purification

    • Evaluate the impact of tag position (N- or C-terminal) on protein function

  • Functional Verification Methods:

    • Develop activity assays specific to the predicted function of FixH

    • Use genetic complementation in fixH mutants to verify functionality of recombinant proteins

    • Study protein-protein interactions with known partners to confirm proper folding and function

What are the current challenges in elucidating the structure-function relationship of FixH?

Researchers face several challenges when investigating the structure-function relationship of FixH:

  • Structural Characterization Difficulties:

    • Membrane or membrane-associated proteins like FixH present challenges for conventional structural biology techniques

    • X-ray crystallography requires obtaining diffraction-quality crystals, which is difficult for membrane proteins

    • NMR spectroscopy is limited by protein size and requires isotopic labeling

    • Cryo-EM may be suitable but requires stable, homogeneous protein preparations

  • Domain Analysis Strategies:

    • Computational prediction tools can identify putative functional domains

    • Site-directed mutagenesis of conserved residues can help identify critical functional regions

    • Construction of chimeric proteins with related Fix proteins can help map functional domains

  • Methodological Approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe protein dynamics and ligand binding

    • Cross-linking coupled with mass spectrometry to map protein-protein interaction interfaces

    • Molecular dynamics simulations to predict protein behavior in membrane environments

  • Functional Correlation:

    • Mutational studies correlating structural features with nitrogen fixation efficiency

    • Heterologous expression of mutant forms in engineered systems like E. coli carrying nitrogen fixation genes

    • In vivo studies using fluorescently tagged FixH to track localization and dynamics

How can contradictory data regarding FixH function across different Rhizobium species be reconciled?

Resolving contradictory data about FixH function requires systematic comparative approaches:

  • Standardized Experimental Framework:

    • Establish consistent experimental conditions across studies

    • Use identical growth media, oxygen concentrations, and assay methods

    • Apply the same genetic manipulation techniques across different species

  • Comparative Genomics Approach:

    • Analyze sequence conservation and divergence of fixH across Rhizobium species

    • Identify species-specific variations that might explain functional differences

    • Create phylogenetic trees of fixH to understand evolutionary relationships

  • Cross-Species Complementation:

    • Perform cross-species complementation experiments using translational fusions (e.g., with lacZ)

    • Evaluate whether fixH from one species can restore function in another species' mutant

    • Analyze expression patterns of fixH promoters in heterologous backgrounds

  • Systematic Deletion Analysis:

    • Create standardized deletion constructs across different species

    • Use methods like FRT-based recombination for precise deletions

    • Compare phenotypic effects under identical conditions

  • Data Integration Strategy:

    • Create comprehensive databases of experimental results

    • Perform meta-analyses of published data to identify patterns and outliers

    • Apply machine learning approaches to predict species-specific functions based on sequence variations

What are the most promising experimental designs for studying FixH function in planta?

Advanced in planta experimental designs for studying FixH function include:

  • Split-Root Experimental Systems:

    • Divide plant root systems to allow simultaneous inoculation with different bacterial strains

    • Compare wild-type and fixH mutant bacteria on the same plant

    • Analyze systemic and local responses to different nitrogen fixation efficiencies

  • Microscopy and Imaging Techniques:

    • Use fluorescently tagged FixH to track protein localization within bacteroids

    • Apply confocal microscopy for high-resolution imaging of protein distribution

    • Use FRET-based approaches to study protein-protein interactions in live nodules

  • Metabolomic Analysis:

    • Compare metabolite profiles in nodules containing wild-type versus fixH mutant bacteria

    • Track the flow of fixed nitrogen using 15N labeling

    • Identify metabolites that might be altered in fixH mutants, potentially revealing function

  • Transcriptomic and Proteomic Studies:

    • Perform RNA-seq on nodules containing wild-type versus fixH mutant bacteria

    • Use laser capture microdissection to isolate specific nodule zones for analysis

    • Apply proteomics to identify proteins with altered abundance in fixH mutants

  • Factorial Experimental Design:

    • Apply factorial design principles to test multiple variables simultaneously:

      • Different plant hosts (alfalfa variants, other legumes)

      • Environmental conditions (temperature, soil composition)

      • Bacterial strain variations (wild-type, fixH mutants, complemented mutants)

    • This approach maximizes information while controlling for variation

Table 1: Comparative Expression of fix Genes Under Different Conditions

GeneFree-living MicroaerobicSymbioticNitrogen StarvationHost Plant Specificity
nifALow activation except in R. tropiciHigh in R. tropiciVariableHost-dependent
fixKLow activation except in R. tropiciHigh in R. tropiciVariableHost-dependent
nifHHigh in R. tropici and R. leguminosarum bv. phaseoliStrong heterologous activationWeak activationRequires NifA binding site (UAS)
fixALowStrong heterologous activationWeak activationRequires IHF binding site
fixHVariableHigh expression during symbiosisLow expressionSpecies-dependent

Table based on data from analysis of expression from Rhizobium meliloti fix-promoters in other rhizobia

How can emerging genetic technologies be applied to advance FixH research?

Emerging genetic technologies offer new opportunities for FixH research:

  • CRISPR-Cas9 Applications:

    • Precise genome editing to create clean deletions or point mutations in fixH

    • CRISPRi for tunable repression of fixH expression

    • CRISPRa for enhanced expression under non-inducing conditions

    • Base editing for introducing specific amino acid changes without double-strand breaks

  • Single-Cell Approaches:

    • Single-cell RNA-seq to understand cell-to-cell variability in fixH expression

    • Time-lapse microscopy with fluorescent reporters to track dynamic expression

    • Microfluidic devices to manipulate and analyze individual bacteroids

  • Synthetic Biology Approaches:

    • Reconstruct minimal fix gene clusters in heterologous hosts

    • Design synthetic regulatory circuits to control fixH expression

    • Create chimeric proteins to test domain functionality

    • Engineering nitrogen fixation pathways in non-fixing organisms using fixH and related genes

  • Advanced Recombination Methods:

    • Lambda integrase recombination systems adapted for use with S. meliloti

    • FRT-based recombination for marker-free deletion construction

    • In vivo recombination through conjugation for efficient genetic manipulation

  • In Silico Approaches:

    • Protein structure prediction using AlphaFold2 or similar tools

    • Molecular docking to predict interactions with other Fix proteins

    • Systems biology modeling of the entire nitrogen fixation network

What statistical approaches are recommended for analyzing FixH expression data?

Statistical analysis of FixH expression data requires careful consideration of experimental design and data characteristics:

  • Experimental Design Considerations:

    • Factorial designs allow analysis of multiple factors simultaneously and can reveal interactions between variables

    • Randomized complete block designs help control for batch effects

    • Time-series designs capture dynamic changes in expression

  • Statistical Tests and Models:

    • ANOVA for comparing expression across multiple conditions

    • Linear mixed-effects models when dealing with repeated measures or nested designs

    • Non-parametric tests (Kruskal-Wallis, Mann-Whitney) when normality assumptions are violated

    • Bayesian approaches for integrating prior knowledge with new data

  • Multiple Testing Correction:

    • Apply methods like Benjamini-Hochberg for controlling false discovery rate

    • Use Bonferroni correction when a strict control of family-wise error rate is needed

  • Data Visualization Strategies:

    • Employ bar plots with error bars for simple comparisons

    • Use heat maps for visualizing expression patterns across multiple conditions

    • Create volcano plots for identifying significant changes in expression

  • Software and Tools:

    • R with packages like limma, DESeq2, or edgeR for differential expression analysis

    • GraphPad Prism for straightforward statistical tests and high-quality visualizations

    • Custom scripts for experiment-specific analyses

How can researchers validate contradictory results in FixH functional studies?

When faced with contradictory results in FixH research, a systematic validation approach is essential:

  • Methodological Cross-Validation:

    • Repeat experiments using multiple methodologies (e.g., qPCR, Western blotting, reporter assays)

    • Verify findings using different experimental systems (in vitro, ex vivo, in planta)

    • Collaborate with independent laboratories to replicate critical findings

  • Genetic Approach:

    • Create multiple independent mutant lines using different strategies

    • Use complementation studies with various fixH alleles

    • Perform allelic replacement rather than insertional mutagenesis

  • Control Variables Rigorously:

    • Standardize growth conditions, especially oxygen levels

    • Control for genetic background differences

    • Account for plant genotype variability in symbiosis experiments

  • Meta-Analysis Framework:

    • Systematically compare methodologies across contradictory studies

    • Identify potential sources of variation (strain differences, growth conditions, assay methods)

    • Weight findings based on methodological rigor and sample size

  • Address Biological Complexity:

    • Consider that contradictions may reflect genuine biological complexity

    • Investigate strain-specific or condition-specific effects

    • Examine interactions with other genetic factors that may modulate FixH function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.