Recombinant Rhizobium meliloti Nodulation protein E (nodE)

Shipped with Ice Packs
In Stock

Description

Introduction

Rhizobium meliloti is a Gram-negative bacterium that establishes a symbiotic relationship with leguminous plants like alfalfa (Medicago sativa) . This symbiosis leads to the formation of root nodules, where bacteria fix atmospheric nitrogen into ammonia, which the plant can use . The nodulation (nod) genes in R. meliloti are essential for this process, facilitating the recognition, infection, and nodule development on the host plant . Among these genes, nodE plays a crucial role in determining the host range specificity of Rhizobium species .

Genetic Context of nodE

The nod genes are a group of bacterial genes involved in the nodulation of legumes. These genes can be classified into common nod genes (nodABC) and host-specific nod genes (such as nodE, nodF, and nodL) . The nodE gene is often found within the host-specificity region of the nod operon .

Biochemical Function

The nod genes, including nodE, encode enzymes that synthesize lipochitooligosaccharide Nod factors (NFs), which are host-signaling compounds . The host plant responds to NF by initiating root nodule morphogenesis and differentiation .

The nodE gene influences the structure of the N-acyl chain of Nod factors, which is critical for host specificity . Specifically, NodE is involved in the N-acylation of Nod factors with unsaturated fatty acids, which are required for R. tropici to nodulate alfalfa .

Impact on Nodulation

  1. R. meliloti nodABC Genes: The common nod genes of R. meliloti are required for the nodulation of alfalfa . Mutations in nodA have the greatest effect, while a mutation in nodJ has no significant effect .

  2. nodFE: Inactivation of the nodFE genes provokes a strong decrease in nodulation, similar to the loss of the nodL gene, suggesting that N-acylation with unsaturated C16 fatty acids is required to allow R. tropici to nodulate alfalfa .

Molecular Studies and Mutant Analysis

  • NodA Protein Purification: The 21-kDa putative nodA protein product has been purified by gel electrophoresis, selective precipitation, and ion-exchange chromatography, and antiserum was generated to the purified gene product .

  • Expression Analysis: The level of nodA protein is increased by exposure of R. meliloti cells to plant exudate, indicating regulation of the bacterial nod genes by the plant host .

  • Mutant Strains: Studies using mutant strains with altered nodD1 genes have shown that these mutations can result in either inactive or constitutively active nod gene induction .

Table: Impact of nod Gene Mutations on Nodulation

GeneEffect of MutationReference
nodADrastic effect on nodulation; Tn5 insertion leads to inactivation of downstream genes
nodESignificant decrease in nodulation if inactivated; affects N-acylation with unsaturated C16 fatty acids
nodD1Mutations can result in inactive nod gene induction or constitutive activation, depending on the specific mutation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nodE; hsnB; Nodulation protein E; Host-specificity of nodulation protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
nodE
Target Protein Sequence
MDRRVVITGMGGLCGLGTDTTSIWKWSARRRSAIGPVLNTELHGLKGIVGAEIKALPDHN IDRKQLVSMDRISVLAVIAAHEAMRQAGLSCNEGNALRFGATVGVGLGGWDATEKAYRPS LSTGGRTEIFTGVKAMPSAAACQVSMSLGLRGPVFGVTSACSSANHAIASAVDQIKCGRA DVMLAGGSDAPLVWIVLKAWEAMRALAPDTCRPFSAGRKGVVLGEGAGMAVLESYEHATA RGATILAEVAGVGLSADAFHITAPAVHGPESAMRACLADAGLNAEDVDYLNAHGTGTKAN DQNETTAIKRVFGDHAYSMSISSTKSTHAHCIGAASALEMIACVMAIQEGVVPPTANYRE PDPDCDLDVTPNVPRERKVRVAMSNAFAMGGTNAVLAFKQV
Uniprot No.

Target Background

Function

Proposed to synthesize the fatty acyl chain of NOD factors. Involved in the synthesis of a highly unsaturated fatty acid moiety, a key component of the lipo-oligosaccharide responsible for host specificity.

Protein Families
Beta-ketoacyl-ACP synthases family
Subcellular Location
Cell inner membrane.

Q&A

What is the genomic context of nodE in Rhizobium meliloti?

Rhizobium meliloti (now commonly referred to as Sinorhizobium meliloti) has a complex genome architecture consisting of one chromosome (3.65 Mb) and two megaplasmids, pSymA (1.35 Mb) and pSymB (1.68 Mb) . The nodulation genes, including nodE, are primarily located on the pSymA megaplasmid, which contains most of the symbiotic genes necessary for nodulation and nitrogen fixation. This genomic architecture is highly dynamic, with evidence of natural cointegration and excision events between replicons occurring at sites of sequence homology. Understanding this genomic context is essential when designing experiments involving recombinant nodE, as the genomic environment can influence gene expression and function.

How does nodE functionally relate to other nodulation genes?

The nodE gene functions within a network of nodulation genes, including the well-characterized nodABC operon that has been shown to be conserved between different Rhizobium species . While nodABC genes are involved in the core structure of Nod factors (lipochito-oligosaccharide signaling molecules), nodE encodes an acyl transferase that determines the fatty acid moiety attached to the Nod factor. The complementation studies between different Rhizobium species suggest functional conservation for core nodulation genes, with species-specific genes like nodE contributing to host-specificity. Experimental approaches investigating nodE should consider these functional relationships within the broader nodulation pathway.

How do mutations in nodE affect host specificity?

Mutations in nodE primarily affect the fatty acid composition of the Nod factors produced by Rhizobium meliloti, which in turn influences host range specificity. Unlike mutations in core nodulation genes such as nodABC that may completely abolish nodulation capacity , nodE mutations typically result in altered host range rather than complete loss of nodulation ability. When designing experiments with recombinant nodE, researchers should consider complementation assays on multiple plant hosts to fully characterize the host-specificity effects. The selectivity is evident in studies showing that certain Rhizobium strains can effectively nodulate some legumes but not others, even when core nodulation genes are functionally conserved.

What are the most effective cloning strategies for recombinant nodE expression?

When cloning nodE from Rhizobium meliloti for recombinant expression, researchers should consider several factors:

  • Vector selection: For functional complementation studies, cosmid vectors capable of handling larger DNA fragments (10-45 kb) have proven successful for nodulation genes . These vectors allow the inclusion of natural promoters and regulatory elements.

  • Restriction strategy: Based on successful approaches with other nodulation genes, EcoRI digestion has been effective for isolating functional nodulation genes from R. meliloti . For nodE specifically, identify unique restriction sites that allow complete gene isolation without disrupting coding or regulatory regions.

  • Host selection: E. coli is typically used for initial cloning, but functional studies should ultimately use Rhizobium strains with nodE mutations for complementation assays.

  • Verification method: PCR-based verification strategies similar to those used in genomic architecture studies can confirm successful cloning . Design primers that span the insertion junctions to verify proper orientation and integration.

The experimental approach should include proper controls, including wild-type Rhizobium meliloti and strains with verified nodE mutations to evaluate complementation efficiency.

What methodological approaches best characterize nodE protein function?

To characterize recombinant nodE protein function, a multi-faceted approach is recommended:

  • Biochemical assays: Develop in vitro assays to measure acyltransferase activity using purified recombinant nodE protein, appropriate acyl-CoA donors, and chitin oligosaccharide acceptors.

  • Structural analysis: Express and purify sufficient quantities of nodE for crystallography or cryo-EM studies to determine three-dimensional structure and active sites.

  • Mutagenesis: Perform site-directed mutagenesis of conserved residues to identify catalytic and substrate-binding domains, using both in vitro assays and in vivo complementation studies to assess functional impacts.

  • Interaction studies: Use pull-down assays, yeast two-hybrid, or crosslinking experiments to identify protein-protein interactions between nodE and other nodulation proteins.

  • In vivo validation: Complement nodE-deficient mutants with recombinant constructs and assess nodulation phenotypes on multiple host plants to validate functional restoration.

This comprehensive approach allows researchers to connect biochemical function with biological outcomes in the symbiotic relationship.

How can genomic integration techniques be applied to study nodE function?

Given the complex genomic architecture of Sinorhizobium meliloti with its chromosome and two megaplasmids , several genomic integration techniques can be applied to study nodE:

  • Homologous recombination: Design constructs with homology arms flanking nodE to enable precise gene replacement or modification within its native genomic context on pSymA.

  • Transposon mutagenesis: Utilize Tn5 insertions, which have proven effective in disrupting nodulation gene function in previous studies . Position the insertions carefully to avoid polar effects on downstream genes.

  • CRISPR-Cas9 genome editing: Develop CRISPR-based tools for precise modification of nodE while minimizing off-target effects.

  • Replicon manipulation: Leverage the natural propensity for replicon rearrangements in S. meliloti to study nodE function in different genomic contexts by selecting for spontaneous or induced cointegrations involving the pSymA megaplasmid.

When implementing these techniques, researchers should verify genomic modifications using PCR-based strategies similar to those used to detect natural genomic rearrangements in S. meliloti , followed by functional assays to assess nodulation phenotypes.

How do genomic rearrangements affect nodE expression and function?

The Sinorhizobium meliloti genome exhibits remarkable plasticity, with natural cointegration and excision events occurring between replicons . These genomic rearrangements can potentially impact nodE expression and function through several mechanisms:

  • Altered copy number: Cointegration events may change the effective copy number of nodE, potentially affecting expression levels.

  • Regulatory changes: Rearrangements can disrupt or create new regulatory interactions, altering the expression patterns of nodE in response to plant signals.

  • Co-expression effects: Placement of nodE in new genomic contexts may affect co-expression with other symbiotic genes.

To study these effects, researchers can:

  • Generate strains with different genomic architectures containing nodE, similar to the approach used to create strain CFNX604 with a single 6.68-Mb replicon .

  • Compare nodE expression levels and patterns across these strains using qRT-PCR or RNA-seq.

  • Assess nodulation phenotypes to correlate genomic architecture with functional outcomes.

  • Analyze growth characteristics in both rich and minimal media, as genomic architecture has been shown to affect growth under certain conditions .

This research direction provides insight into how genome organization influences symbiotic gene function.

What is the evolutionary relationship between nodE variants across Rhizobium species?

Understanding the evolutionary relationships between nodE variants requires comparative genomic and functional analyses:

  • Sequence analysis: Collect and align nodE sequences from diverse Rhizobium/Sinorhizobium species to identify conserved and variable regions.

  • Phylogenetic studies: Construct phylogenetic trees based on nodE sequences and compare with species phylogenies to identify potential horizontal gene transfer events.

  • Functional conservation testing: Perform cross-species complementation assays similar to those conducted with nodABC genes to determine the degree of functional conservation of nodE across species.

  • Host range correlation: Map nodE sequence variations to known host range differences among Rhizobium species to identify sequence features that might determine host specificity.

  • Structural predictions: Use homology modeling to predict how sequence variations might affect protein structure and substrate specificity.

This evolutionary perspective provides context for understanding host-specificity determinants and can guide protein engineering efforts to modify host range.

How do epigenetic factors influence nodE expression in symbiotic conditions?

Epigenetic regulation of nodE expression remains poorly understood but may be significant for symbiotic adaptation. To investigate this aspect:

  • Methylation analysis: Use bisulfite sequencing to map DNA methylation patterns in the nodE promoter and coding regions under different symbiotic and free-living conditions.

  • Chromatin immunoprecipitation (ChIP): Identify histone modifications and DNA-binding proteins associated with the nodE locus during symbiotic interactions.

  • Small RNA profiling: Investigate potential post-transcriptional regulation by small RNAs that might target nodE mRNA.

  • Environmental response: Assess how different environmental conditions affect epigenetic markers and correlate with nodE expression levels.

  • Transgenerational effects: Determine if symbiotic interactions create epigenetic memories that affect nodE expression in subsequent generations of Rhizobium.

This research area opens new perspectives on the regulation of symbiotic genes beyond conventional transcriptional control mechanisms.

How does nodE functionally interact with the nodABC operon products?

The functional interaction between nodE and the nodABC operon products is critical for producing host-specific Nod factors. Research approaches to characterize these interactions include:

  • Co-expression studies: Express recombinant nodE alongside nodABC in heterologous systems to reconstitute the Nod factor biosynthetic pathway.

  • In vitro reconstitution: Purify individual proteins and assess their sequential activities in Nod factor synthesis, determining the precise point at which nodE acts.

  • Protein-protein interaction assays: Use techniques such as co-immunoprecipitation, FRET, or bacterial two-hybrid systems to detect direct interactions between nodE and other nodulation proteins.

  • Substrate competition assays: Determine if nodE and other enzymes compete for shared substrates or if they form a coordinated enzymatic complex.

  • Structural biology approaches: Co-crystallize nodE with other nodulation proteins to visualize interaction interfaces.

Understanding these functional interactions provides insight into the molecular assembly line that produces host-specific signal molecules.

What structural features distinguish nodE from other acyltransferases?

To identify the unique structural features of nodE compared to other acyltransferases:

  • Sequence alignment: Compare nodE with other bacterial acyltransferases to identify conserved catalytic domains and unique regions.

  • Homology modeling: Generate structural models based on crystallized acyltransferases to predict the three-dimensional organization of nodE.

  • Substrate docking simulations: Use computational approaches to model how nodE might interact with its substrates compared to other acyltransferases.

  • Domain swapping experiments: Create chimeric proteins between nodE and other acyltransferases to identify domains responsible for substrate specificity.

  • Site-directed mutagenesis: Target predicted unique structural features to confirm their importance for nodE-specific functions.

This structural understanding can guide protein engineering efforts to modify substrate specificity and potentially alter host range.

How do plant host factors interact with Nod factors produced by nodE activity?

The specificity of the symbiotic relationship depends on recognition between plant host factors and the Nod factors produced through nodE activity. To investigate these interactions:

  • Receptor binding assays: Isolate plant Nod factor receptors and assess binding affinities with Nod factors produced by wild-type and recombinant nodE variants.

  • Plant mutant studies: Use plant host mutants defective in Nod factor perception to identify genetic components involved in recognizing nodE-specific Nod factor modifications.

  • Structure-activity relationship studies: Systematically modify the fatty acid moieties introduced by nodE and correlate with host response to identify critical recognition features.

  • Signaling cascade analysis: Monitor early symbiotic signaling events in plant hosts exposed to Nod factors from various nodE variants.

  • Co-crystallization studies: Attempt to co-crystallize plant receptor domains with Nod factors to visualize the molecular basis of recognition.

These approaches connect bacterial nodE function with plant host responses, providing a comprehensive view of the molecular dialogue underpinning symbiosis.

What are common pitfalls in recombinant nodE expression systems?

Researchers frequently encounter several challenges when working with recombinant nodE:

  • Solubility issues: nodE may form inclusion bodies in heterologous expression systems. Strategies to address this include:

    • Lower induction temperatures (16-20°C)

    • Co-expression with chaperones

    • Fusion tags that enhance solubility (MBP, SUMO)

    • Native purification from Rhizobium

  • Proper folding: Even when soluble, recombinant nodE may not adopt its native conformation. Consider:

    • Including cofactors during expression/purification

    • Testing multiple detergents if membrane association is suspected

    • Enzymatic activity assays to confirm functional folding

  • Expression regulation: The natural regulation of nodE expression is complex. To address this:

    • Include sufficient upstream regulatory elements in constructs

    • Consider inducible systems compatible with Rhizobium physiology

    • Test expression under symbiotic mimicking conditions

  • Complementation verification: When performing functional complementation, thoroughly verify:

    • Genomic integration at the correct locus

    • Expression levels comparable to wild-type

    • Testing on multiple host plants to confirm specificity patterns

These considerations help ensure that recombinant nodE accurately represents the native protein's properties and functions.

How can researchers optimize nodulation assays to evaluate recombinant nodE function?

Optimizing nodulation assays for evaluating recombinant nodE function requires attention to several methodological details:

  • Plant growth conditions:

    • Standardize sterile growth systems (e.g., growth pouches, agar plates, vermiculite)

    • Control temperature, light cycles, and humidity consistently

    • Pre-germinate seeds to ensure uniform developmental stage at inoculation

  • Bacterial inoculum preparation:

    • Standardize culture growth phase and density

    • Wash cells to remove extraneous media components

    • Verify plasmid stability in recombinant strains

  • Quantitative assessment parameters:

    • Count nodule numbers at multiple time points (e.g., 7, 14, 21 days post-inoculation)

    • Measure nodule size and distribution along roots

    • Assess nitrogen fixation activity using acetylene reduction assays

    • Measure plant growth parameters (shoot dry weight, nitrogen content)

  • Microscopic analysis:

    • Section nodules to assess internal structure

    • Use fluorescent-tagged bacteria to track infection and colonization

    • Employ electron microscopy to examine bacteroid development

  • Controls:

    • Include wild-type Rhizobium meliloti

    • Use nodE deletion mutants without complementation

    • Test plant-only negative controls

By implementing these optimizations, researchers can obtain reliable and reproducible assessments of how recombinant nodE variants affect the symbiotic process.

What approaches help resolve contradictory data in nodE functional studies?

When faced with contradictory results in nodE functional studies, researchers should implement a systematic troubleshooting approach:

  • Strain verification:

    • Sequence-verify all strains to confirm genetic constructs

    • Check for secondary mutations that might have arisen during manipulation

    • Ensure pure cultures without contamination

  • Experimental conditions:

    • Systematically vary growth conditions to identify environmental factors affecting results

    • Control for plant germplasm genetic variability by using inbred lines

    • Test multiple biological and technical replicates

  • Methodological reconciliation:

    • Compare protocols between contradictory studies in detail

    • Implement multiple methodological approaches to measure the same parameter

    • Collaborate with labs reporting different results to standardize protocols

  • Phenotypic spectrum analysis:

    • Characterize the full range of phenotypes across multiple parameters

    • Look for correlations between different phenotypic measures

    • Consider that contradictions might reflect real biological complexity

  • Genetic background effects:

    • Test recombinant nodE in multiple Rhizobium genetic backgrounds

    • Consider the genomic architecture context, as replicon structure can affect gene function

    • Examine potential interactions with other symbiotic genes

By systematically addressing these factors, researchers can resolve contradictions and develop a more nuanced understanding of nodE function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.