Recombinant Rhizobium meliloti Octopine transport system permease protein occM (occM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
occM; Octopine transport system permease protein OccM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
occM
Target Protein Sequence
MPFDPLFLWETFIALLAGIPLALKLAVFSIAVGTVLAFSLALMRVSRRWWLDFPARFYIF AFRGTPLLVQIYIIYYGLSQFPGLRHSLLWPFLREAYWCALGALALNTAAYSAEIMRGGL LSVPAGQIEAARACGMARVLLFRRIIIPQAIRQMLPGYSNEVVLMVKSTSLASTITLMEI TGIAAKLISETYRPVEVFACAGAIYLTMNFIAARLFALIEWSLWPERRKTRRPVDLADQK GELHV
Uniprot No.

Target Background

Function
A component of the octopine active transport system, likely composed of four subunits: Q, M, P, and T.
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the occM protein and what is its function in bacterial systems?

The occM protein is a permease component of the octopine transport system found in Rhizobium species, including strains formerly classified as Agrobacterium. It functions as part of a membrane-bound complex responsible for the uptake of octopine, which is an opine compound [N2-(1-D-carboxyethyl)-L-arginine] produced in plant tumors induced by these bacteria . The occM protein is encoded within the occ region of Ti plasmids, which confers the ability to catabolize octopine but not nopaline to bacterial hosts .

Functionally, occM operates alongside other proteins in a binding protein-dependent transport system, with similarity to transport systems for basic amino acids in other bacterial species . Within this system, occM appears to be one of three polypeptides localized to the bacterial membrane, working in concert with a periplasmic protein to facilitate octopine uptake across the cell membrane . This transport capability represents a critical adaptation that allows these bacteria to utilize plant-produced opines as nutrient sources.

What are the primary experimental methods used to study occM protein function?

The primary experimental methods for studying occM protein function include:

  • DNA sequence analysis: To identify gene organization and predict protein structure through comparative analysis with known transport systems .

  • Functional cassette construction: Creating constructs containing either putative transport genes alone or complete occ regions, including regulatory elements necessary for opine-induced expression .

  • Radioactive uptake studies: Using 3H-labelled octopine to quantitatively measure transport activity in bacterial cells expressing the occM protein and associated transport system components .

  • Mutational analysis: Creating targeted gene disruptions to verify the role of specific genes in opine transport capabilities .

  • Recombinant protein expression: Producing recombinant versions of the protein for structural and functional studies .

These methods collectively provide a comprehensive approach to understanding both the genetic context and functional role of the occM protein in bacterial opine transport systems.

How do experimental design principles impact occM protein functional studies?

Experimental design principles significantly impact the quality and reliability of occM protein functional studies. When investigating membrane transport proteins like occM, researchers must employ rigorous design approaches to ensure meaningful results while addressing several key challenges:

  • Sample optimization: Given the complex nature of membrane protein studies, researchers should consider implementing designed sampling approaches rather than random sampling. Studies show that designed subsampling can yield higher information utility with smaller sample sizes, potentially doubling efficiency compared to random approaches .

  • Control of correlation structures: The experimental design must account for potential correlations between variables. As demonstrated in comparative studies, different correlation structures (positive, negative, or no correlation) between experimental variables can significantly impact the observed utility of designed versus random sampling approaches .

  • Data-guided design optimization: In occM research, optimal experimental design values should guide covariate selection, though researchers must be aware that in real datasets, it may be difficult to find experimental conditions that perfectly match optimal design parameters, particularly when there is negative correlation between variables .

  • Utility function selection: For occM transport studies, researchers should select appropriate utility functions based on the observed information matrix from collected data and the expected information matrix from potential additional observations . This approach helps maximize information gain throughout the experimental process.

The implementation of these principles can be visualized in the following utility comparison table:

Experimental ApproachCovariance StructureParameter EstimatesObserved Utility
Designed SubsetNo correlation(-1.11, 0.33, 0.11)18.9
Full DatasetNo correlation(-1.02, 0.31, 0.10)24.7
Designed SubsetPositive correlation(-0.91, 0.27, 0.13)19.3
Full DatasetPositive correlation(-1.00, 0.31, 0.10)24.4
Designed SubsetNegative correlation(-1.04, 0.31, 0.15)17.3
Full DatasetNegative correlation(-1.03, 0.32, 0.12)24.6

This table demonstrates that while full datasets provide higher utility, well-designed experimental subsets can achieve substantial utility with significant resource savings .

What are the structural and functional differences between occM proteins in Rhizobium meliloti versus other Rhizobium species?

The structural and functional differences between occM proteins in Rhizobium meliloti and other Rhizobium species (such as R. radiobacter, formerly Agrobacterium tumefaciens) represent an important area of comparative research:

  • Sequence homology analysis: While the occM proteins across Rhizobium species share fundamental functional similarities as components of opine transport systems, sequence variations exist that may impact substrate specificity and transport efficiency . These differences likely reflect evolutionary adaptations to specific ecological niches.

  • Domain organization: Comparative structural analysis suggests that occM proteins across Rhizobium species maintain the core transmembrane architecture typical of permease components in binding protein-dependent transport systems, but may differ in specific transmembrane regions that influence substrate recognition .

  • Regulatory control: The expression control mechanisms may differ between species, though the general principle of opine-inducible expression through dedicated regulatory proteins appears conserved . In R. radiobacter/A. tumefaciens, this regulation occurs through the occR protein .

  • Functional integration: The occM protein operates within a transport complex containing multiple components. The efficiency of this integrated system may vary between species due to co-evolutionary adaptations among the component proteins .

Methodologically, these differences are best studied through comparative genomics, recombinant expression systems, and transport assays using isotope-labeled substrates to quantify functional variations between the orthologous proteins .

How can advanced computational methods enhance occM protein structural prediction and functional analysis?

Advanced computational methods offer powerful approaches to enhance occM protein structural prediction and functional analysis, particularly important for membrane proteins that present challenges for traditional structural determination techniques:

For researchers working with large datasets related to occM or similar transport proteins, the utility of designed subsampling versus random sampling can be visualized through convergence analysis, comparing information gained per observation between different sampling strategies .

What are the challenges in expressing and purifying functional recombinant occM protein for structural studies?

Expression and purification of functional recombinant occM protein present significant challenges that researchers must address through methodological innovations:

  • Membrane protein expression barriers:

    • The hydrophobic nature of occM as a membrane permease protein creates expression toxicity in common host systems

    • Proper insertion into membranes requires specialized expression hosts with appropriate membrane insertion machinery

    • Expression levels are typically lower than for soluble proteins, necessitating optimization of induction conditions and host strain selection

  • Solubilization and stability considerations:

    • Selection of appropriate detergents that maintain protein structure while effectively solubilizing from membranes

    • Development of stabilization strategies using lipid nanodiscs or amphipols to maintain native-like environments

    • Prevention of aggregation during concentration steps prior to structural studies

  • Functional verification methods:

    • Development of activity assays compatible with detergent-solubilized protein

    • Use of isotope-labeled substrates (e.g., 3H-labelled octopine) to verify transport function in reconstituted systems

    • Implementation of binding assays to confirm substrate interaction in the absence of complete transport capability

  • Purification strategy optimization:

    • Design of purification tags that minimize interference with protein folding and function

    • Implementation of multi-step purification protocols with minimal exposure to harsh conditions

    • Quality control by size-exclusion chromatography to verify monodispersity and proper oligomeric state

Current commercial sources provide recombinant versions of related proteins (e.g., from Rhizobium radiobacter) , but researchers working with Rhizobium meliloti occM must typically develop custom expression and purification protocols optimized for their specific research objectives.

What experimental design principles should be applied when studying occM protein interactions with other transport components?

When studying occM protein interactions with other transport components, researchers should implement the following experimental design principles:

  • Systematic interaction mapping: Design experiments that systematically test interactions between occM and other components of the opine transport system, including the periplasmic binding protein and other membrane-associated components . This approach should utilize both in vivo and in vitro methods to validate interactions.

  • Utility-based experimental optimization: Instead of randomly selecting experimental conditions, implement a utility function approach that maximizes information gain throughout the experimental process . The utility function should incorporate:

    U(d)=det(In(θ,Xn)+Ie(θ,d))U(d*) = \det(I_n(θ, X_n) + I_e(θ, d*))

    Where I_n represents the observed information matrix from data collected so far, and I_e represents the expected information matrix if design d* is applied for the next observation .

  • Strategic subsampling for large-scale analyses: When working with high-throughput interaction data, implement retrospective designed sampling rather than random subsampling . This approach has demonstrated approximately double the efficiency compared to random sampling in datasets with uncorrelated or positively correlated variables .

  • Cross-validation structures: Design experiments with appropriate replication and control structures that allow for robust statistical analysis. For example, when working with mutant constructs, ensure appropriate controls are included to isolate the specific effects of occM mutations versus those in other transport components .

  • Integration of computational and experimental approaches: Design experiments that can validate computational predictions about occM interactions, creating a feedback loop between computational modeling and experimental validation .

By applying these principles, researchers can optimize resource utilization while maximizing information gain about occM protein interactions within the transport system complex.

How can isotope labeling techniques be optimized for studying occM-mediated transport kinetics?

Isotope labeling techniques represent powerful approaches for studying occM-mediated transport kinetics, but require careful optimization:

  • Selection of appropriate isotopes: While 3H-labelled octopine has been successfully used to study transport mediated by the occ region , researchers should consider:

    • Using 14C labeling for longer-term experiments due to reduced radiation safety concerns

    • Employing 13C or 15N labeling for NMR-based structural studies combined with transport assays

    • Strategic isotope positioning within the substrate molecule to track specific breakdown products

  • Time-course design optimization: Rather than arbitrary time points, researchers should design time-course experiments based on:

    • Preliminary data to identify critical phases of transport

    • Statistical power calculations to determine optimal sampling frequency

    • Implementation of utility-based experimental design principles to maximize information from minimal measurements

  • Competition assay methodology: For determining substrate specificity:

    • Design competition assays with unlabeled potential substrates at varying concentrations

    • Calculate accurate inhibition constants (Ki values) through proper experimental design

    • Implement factorial designs to identify potential interactions between different substrates

  • Environmental variable control: Control and systematically vary:

    • pH conditions to identify optimal transport pH and proton co-transport effects

    • Ion concentrations to determine co-transport or counter-transport mechanisms

    • Energy source availability to distinguish active versus passive transport components

  • Data analysis optimization: Implement appropriate kinetic modeling approaches:

    • Use non-linear regression with proper weighting based on measurement uncertainty

    • Apply compartmental modeling for complex transport processes

    • Consider Bayesian approaches for parameter estimation with prior knowledge incorporation

By optimizing these methodological aspects, researchers can obtain more reliable kinetic parameters for occM-mediated transport, including Km, Vmax, and substrate specificity profiles with greater precision and using fewer resources.

What are the recommended approaches for generating occM protein mutants to study structure-function relationships?

  • Rational design based on sequence alignment:

    • Identify conserved residues across related transport proteins in different Rhizobium species

    • Target residues in predicted transmembrane domains that may be involved in substrate recognition

    • Focus on charged residues in transmembrane segments, which often play crucial roles in transport mechanisms

  • Systematic alanine scanning:

    • Design a comprehensive alanine scanning mutagenesis plan focusing on predicted functional domains

    • Implement this in phases, starting with regions most likely to affect function

    • Use designed experimental approaches rather than random scanning to maximize information gain

  • Domain swapping strategies:

    • Create chimeric proteins exchanging domains between occM from R. meliloti and related species

    • Design constructs that maintain proper membrane topology and folding

    • Include appropriate linker regions to preserve structural integrity

  • Site-directed mutagenesis protocol optimization:

    • Modify traditional protocols to accommodate the GC-rich nature of Rhizobium genomic DNA

    • Implement touchdown PCR approaches to improve specificity

    • Use methylation-sensitive host strains to improve cloning efficiency

  • Expression system selection:

    • Choose expression systems compatible with membrane protein production

    • Consider inducible systems with tunable expression levels to minimize toxicity

    • Employ fusion tags that facilitate detection without interfering with transport function

  • Functional validation methodology:

    • Develop rapid screening assays to identify mutations affecting transport

    • Implement isotope uptake assays using 3H-labelled octopine as demonstrated in previous research

    • Design complementation studies in transport-deficient bacterial strains

By systematically implementing these approaches, researchers can generate a library of occM mutants that illuminate the relationship between protein structure and transport function, ultimately contributing to a more comprehensive understanding of the molecular mechanisms of opine transport.

How might occM protein research contribute to understanding plant-microbe interactions in agricultural contexts?

Research on the occM protein has significant potential to advance our understanding of plant-microbe interactions in agricultural contexts through several interconnected pathways:

  • Rhizosphere communication mechanisms: The occM protein's role in opine transport represents part of a sophisticated chemical communication system between plants and soil bacteria . Further research could reveal how these transport systems influence bacterial colonization patterns and plant growth promotion activities.

  • Biological nitrogen fixation enhancement: By understanding how transport systems like occM function in different Rhizobium species, researchers may develop strategies to enhance symbiotic relationships, particularly in R. meliloti which forms nitrogen-fixing nodules with leguminous plants, unlike the pathogenic interactions of A. tumefaciens.

  • Pathogen exclusion strategies: Knowledge of opine transport mechanisms could inform the development of competitive exclusion approaches, where beneficial bacteria equipped with efficient transport systems outcompete pathogens for plant-derived resources.

  • Engineered microbiomes: Precision modification of occM and related transport proteins could lead to engineered rhizobacteria with enhanced ability to establish in the rhizosphere and deliver beneficial functions to crop plants.

  • Sustainable agriculture applications: The fundamental understanding of plant-microbe molecular dialogues through compounds transported by systems including occM could inform new approaches to reduce chemical inputs in agriculture through optimized microbial partnerships.

Future research should employ advanced experimental design principles to maximize information gain while minimizing resource expenditure , particularly important in field-based agricultural research where variables are numerous and often correlated.

What computational approaches show the most promise for predicting occM protein interactions with novel substrates?

Computational approaches for predicting occM protein interactions with novel substrates are rapidly evolving, with several methodologies showing particular promise:

  • Molecular dynamics simulations with enhanced sampling: These approaches can model the interaction between occM protein and potential substrates across multiple timescales, revealing binding energy landscapes and conformational changes associated with transport. Recent advances in specialized force fields for membrane proteins have significantly improved prediction accuracy.

  • Machine learning approaches: By training on known substrate profiles of related transport proteins, machine learning algorithms can predict novel substrate interactions based on molecular descriptors. This approach benefits from:

    • Feature selection strategies to identify the most relevant molecular properties

    • Transfer learning from related transporters with larger experimental datasets

    • Active learning frameworks that prioritize experimental validation for most informative predictions

  • Quantum mechanics/molecular mechanics (QM/MM) methods: For detailed analysis of substrate coordination within the binding site, hybrid QM/MM approaches offer superior accuracy in modeling electronic interactions crucial for substrate recognition.

  • Network pharmacology approaches: These methods consider the occM protein within its broader functional network, predicting how substrate binding may influence interactions with other components of the transport system.

  • Big data integration with designed subsampling: When analyzing large virtual screening datasets, implementing principled experimental design methods for retrospective designed sampling rather than random subsampling can significantly improve computational efficiency . This approach has demonstrated approximately double the statistical efficiency compared to random sampling .

For computational studies generating large datasets, researchers should consider the observed correlation structures within their data, as this impacts the relative efficiency of designed versus random sampling approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.