Recombinant Rhizobium meliloti Probable K (+)/H (+) antiporter subunit C (phaC)

Shipped with Ice Packs
In Stock

Description

Protein Topology and Location

PhaC is classified as a multi-pass membrane protein that is integrated into the cell membrane of R. meliloti . The topological arrangement of phaC includes the three transmembrane segments organized in a specific configuration that creates ion transport pathways through the membrane. This arrangement is essential for the protein's function in facilitating the exchange of potassium and hydrogen ions across the membrane barrier.

The following table summarizes the key structural characteristics of the phaC protein:

CharacteristicValue
Protein NamePhaC (Probable K+/H+ antiporter subunit C)
Gene NamesphaC, phaC1
Length115 amino acids
Molecular Weight12,214 Daltons
Transmembrane Segments3
Cellular LocationCell membrane
TopologyMulti-pass membrane protein
Transported SubstratesPotassium (K+), hydrogen (H+), sodium (Na+)

Functional Role in Bacterial Physiology

The phaC protein serves crucial functions in the physiology of Rhizobium meliloti, contributing to the bacterium's ability to survive in changing environmental conditions and establish symbiotic relationships with host plants.

Role in pH Homeostasis and Alkaline Adaptation

One of the primary functions of the phaC protein is its participation in a K+ efflux system that helps R. meliloti adapt to alkaline pH conditions . This system is part of the bacterium's mechanism for maintaining internal pH homeostasis when exposed to external alkaline environments. By facilitating the exchange of potassium and hydrogen ions across the membrane, phaC contributes to the regulation of cytoplasmic pH, which is essential for the function of cellular enzymes and metabolic processes.

The phaC protein likely works as part of a larger multisubunit complex, similar to other bacterial monovalent cation/proton antiporters. Evidence suggests that phaC functions in a manner similar to the MrpC subunit in related antiporter systems, which couple the efflux of sodium or potassium ions to the influx of protons . This ion exchange mechanism helps establish and maintain electrochemical gradients across the membrane, which are crucial for energy conservation and cellular homeostasis.

Significance in Symbiotic Processes

Beyond its role in pH adaptation, the phaC protein has been identified as a component required for the infection process during the establishment of symbiotic relationships between R. meliloti and host plants, particularly alfalfa . This symbiotic relationship is characterized by the formation of nitrogen-fixing root nodules, where the bacteria convert atmospheric nitrogen into forms that can be utilized by the host plant.

Relationship to Other Membrane Transport Systems

The phaC protein belongs to a larger family of membrane transport proteins and shares similarities with components of other ion transport systems found across bacterial species.

Homology to Other Transport Systems

Research indicates that the MrpC subunit, which is functionally similar to phaC, shows striking resemblance to the NuoK subunit of Complex I (NADH:quinone oxidoreductase) in the bacterial respiratory chain . This similarity suggests an evolutionary relationship between ion antiporter systems and components of the electron transport chain, highlighting potential shared mechanisms in proton translocation and energy coupling.

The relationship between phaC and components of complex I may provide insights into how these membrane proteins evolved to perform specialized functions in different cellular contexts. It also suggests that the fundamental mechanisms of ion transport may be conserved across diverse membrane protein complexes.

Functional Comparisons with Related Transporters

The phaC protein functions as part of a system analogous to the Mrp (Multi-subunit cation/proton) antiporter complex found in various bacteria. In systems like the one found in Bacillus pseudofirmus OF4, Mrp antiporters specifically couple Na+ efflux to H+ influx, with the transport process energized by a transmembrane pH gradient (ΔpH) .

Similar to these related systems, the phaC-containing antiporter in R. meliloti likely exhibits electrogenicity in its transport mechanism, meaning that the ion exchange process results in a net movement of charge across the membrane. This property is particularly important for the function of such antiporters in alkaline environments where the membrane potential (ΔΨ) becomes the predominant driving force for ion transport .

Recombinant Protein Production

Recombinant Rhizobium meliloti Probable K (+)/H (+) antiporter subunit C (phaC) is produced using various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . These expression systems allow for the production of the protein with high purity (≥85% as determined by SDS-PAGE) , making it suitable for a variety of research applications.

Commercial sources offer both full-length and partial versions of the recombinant phaC protein. The availability of these protein preparations facilitates research into the structure, function, and interactions of this important membrane transport protein.

Research Applications

The availability of recombinant phaC enables various research applications, including:

  1. Structural studies to determine the three-dimensional arrangement of the protein and its transmembrane domains

  2. Functional reconstitution experiments to assess ion transport activities in artificial membrane systems

  3. Interaction studies to identify partner proteins and components of the complete antiporter complex

  4. Immunological studies using antibodies raised against the recombinant protein

  5. Comparative analyses with homologous proteins from other bacterial species

These research applications contribute to a better understanding of bacterial ion transport mechanisms and their roles in pH adaptation and symbiotic processes.

Current Research Directions and Future Perspectives

Research on the phaC protein and related ion transport systems continues to evolve, with several promising directions for future investigation.

Ongoing Research Efforts

Current research efforts likely focus on elucidating the complete structure of the phaC protein and the multisubunit complex in which it functions. Advanced techniques such as cryo-electron microscopy and X-ray crystallography may be employed to determine the three-dimensional structure of the protein at high resolution, providing insights into the molecular mechanisms of ion transport.

Functional studies using reconstituted systems and site-directed mutagenesis approaches are also important areas of ongoing research. These studies can help identify specific amino acid residues that are critical for ion binding, transport, and regulatory interactions.

Potential Biotechnological Applications

Understanding the structure and function of phaC and related ion transport proteins has potential applications in several areas of biotechnology:

  1. Development of engineered bacteria with enhanced tolerance to alkaline conditions for industrial processes

  2. Improvement of symbiotic nitrogen fixation for sustainable agriculture

  3. Design of novel antimicrobial compounds targeting bacterial ion transport systems

  4. Creation of biosensors for monitoring environmental pH or ion concentrations

These applications highlight the broader significance of research on phaC and related membrane transport proteins beyond fundamental microbiology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
phaC; phaC1; R02911; SMc03180; Probable K(+/H(+ antiporter subunit C; pH adaptation potassium efflux system protein C; Pha system subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
phaC
Target Protein Sequence
MELILSAGIGTLTASGVYLLLRPRTYQVIIGLSLLSFAVNLFIFGMGRLRVNAPPILDPG GVGDLARYTDPVPQALVLTAIVIGFAMTALFLVVLLASRGFTGTDHVDGREQRGD
Uniprot No.

Target Background

Function
This protein is part of a K(+) efflux system crucial for Rhizobium meliloti's adaptation to alkaline pH and its infection process during symbiotic nodule development.
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of the phaC gene in Rhizobium meliloti?

The phaC gene in Rhizobium meliloti encodes a probable K(+)/H(+) antiporter subunit C, which is part of the membrane transport system involved in maintaining ion homeostasis. This gene is typically found within the main chromosome of R. meliloti strain 1021, which consists of a 3.65 Mb chromosome and two megaplasmids, pSymA (1.35 Mb) and pSymB (1.68 Mb) . The gene is one of the 6,207 protein-coding genes predicted in the R. meliloti genome, and like other membrane transport proteins, it plays a role in the adaptation of the bacteria to different environmental conditions, particularly in soil environments and during symbiotic relationships with legume hosts.

How can I clone the phaC gene from Rhizobium meliloti using modern recombination methods?

For efficient cloning of the phaC gene from R. meliloti, lambda integrase recombination methods offer significant advantages:

  • Gateway cloning approach:

    • Amplify the complete phaC ORF using PCR with primers containing attB recombination sites

    • Perform a BP reaction to insert the gene into a donor vector containing attP sites

    • Transform into E. coli and select for resistance markers

    • Use LR reaction to transfer the gene to the destination vector with plasmid oriT sequences

    • Transfer to R. meliloti by conjugation via pentaparental mating protocol

This approach saves considerable time compared to traditional restriction enzyme-based cloning methods and allows for easy transfer between different vector systems for varied experimental purposes .

What are the established expression systems for producing recombinant phaC protein?

When expressing recombinant phaC protein from R. meliloti, researchers typically employ one of these systems:

Expression SystemAdvantagesDisadvantagesTypical Yield
E. coli (BL21)High yield, rapid growth, simple inductionPotential folding issues with membrane proteins2-5 mg/L culture
Native R. melilotiCorrect post-translational modificationsLower yield, slower growth0.5-1 mg/L culture
Yeast expression (P. pastoris)Eukaryotic processing, secretion possibleLonger development time1-3 mg/L culture

For membrane proteins like phaC, expression in the native host (R. meliloti) often produces the most functionally relevant protein, despite lower yields. The choice should be guided by the specific experimental requirements.

What are the optimal conditions for mutagenesis studies of the phaC gene in Rhizobium meliloti?

For targeted mutagenesis of the phaC gene, the FRT recombination method has proven particularly effective:

  • Construction of deletion vectors:

    • Clone the phaC gene and flanking regions into a suicide vector containing FRT sequences

    • Integrate this vector into the R. meliloti genome via homologous recombination

    • Express Flp recombinase to catalyze site-specific recombination between the FRT sites

    • Select for deletion mutants where the end points of deletions are precisely located at gene boundaries

This approach allows for the creation of clean deletion mutations where you can precisely control the endpoints of the deletion. The method has been successfully applied to create deletion mutations in multiple genes in R. meliloti, particularly in the denitrification cluster on pSymA .

How can the functional activity of phaC be measured in experimental settings?

The functional activity of the phaC antiporter protein can be assessed through several complementary approaches:

  • Ion flux measurements:

    • Prepare membrane vesicles from cells expressing wild-type or mutant phaC

    • Load vesicles with specific fluorescent dyes sensitive to K+ or H+ concentrations

    • Monitor ion flux spectrofluorometrically upon addition of substrate

    • Calculate transport rates based on fluorescence changes

  • Growth complementation assays:

    • Construct a phaC deletion mutant showing growth defects under specific ionic conditions

    • Transform with plasmids expressing wild-type or mutant phaC variants

    • Compare growth rates under different K+ concentrations or pH conditions

    • Quantify complementation efficiency based on growth recovery

  • Electrophysiological measurements:

    • Reconstitute purified phaC protein in artificial lipid bilayers

    • Measure ion currents using patch-clamp techniques

    • Determine substrate specificity and transport kinetics

These methodologies provide comprehensive functional characterization of the antiporter activity and can reveal structure-function relationships when combined with site-directed mutagenesis.

What approaches should be used to investigate phaC involvement in symbiotic interactions with legume hosts?

Investigating the role of phaC in symbiotic relationships requires integrated methodological approaches:

  • Symbiotic phenotype characterization:

    • Generate precise phaC deletion mutants using FRT-based recombination methods

    • Inoculate alfalfa (Medicago sativa) seedlings with wild-type and mutant strains

    • Assess nodule formation, nitrogen fixation rates, and bacteroid development

    • Conduct time-course analyses to detect temporal effects during symbiosis establishment

  • Transcriptional regulation analysis:

    • Monitor phaC expression using transcriptional fusions with reporter genes

    • Examine expression levels in free-living conditions versus symbiotic states

    • Identify environmental signals (pH, osmotics, flavonoids) that modulate expression

    • Map the regulatory elements controlling phaC expression

  • Interaction with host-derived signals:

    • Analyze phaC expression changes in response to seed exudates

    • Fractionate exudates to identify specific compounds affecting expression

    • Determine if phaC influences chemotactic responses to host-derived signals

While flavonoids have been traditionally considered important for chemotaxis, recent research indicates that hydrophilic fractions of seed exudates are more significant attractants than flavonoid-containing hydrophobic fractions . This may have implications for understanding how ion transporters like phaC respond during early symbiotic interactions.

How can I overcome solubility issues when purifying recombinant phaC protein?

Membrane proteins like phaC present significant purification challenges. A systematic approach includes:

ChallengeSolution StrategyExpected Outcome
Poor solubilityUse mild detergents (DDM, LMNG)Increased protein stability in solution
AggregationAdd stabilizing agents (glycerol, specific lipids)Reduced aggregation and higher monodispersity
Low yieldOptimize expression conditions (temperature, induction time)2-3 fold improvement in yield
Loss of activityReconstitute in artificial liposomes or nanodiscsMaintenance of functional conformation

The most successful protocols typically employ step-wise detergent screening, coupled with stability assays to identify optimal purification conditions for maintaining protein function throughout the isolation process.

What controls should be included in experiments evaluating phaC function in ion homeostasis?

Rigorous experimental design for studying phaC function requires comprehensive controls:

  • Genetic controls:

    • Wild-type strain as positive control

    • Complete phaC deletion mutant as negative control

    • Complemented mutant to confirm phenotype rescue

    • Strains with point mutations in key functional residues

  • Environmental controls:

    • Standardized growth media composition with defined ion concentrations

    • pH-buffered conditions to isolate K+ transport effects from pH effects

    • Various osmotic conditions to distinguish specific transport from general osmotic responses

    • Growth under microaerobic and aerobic conditions to assess oxygen dependency

  • Technical controls for transport assays:

    • Addition of ionophores as positive controls for membrane permeabilization

    • Use of transport inhibitors to confirm specificity

    • Measurement in the presence of competing ions to assess selectivity

    • Time-course measurements to establish transport kinetics

These controls help distinguish direct phaC effects from indirect physiological responses and ensure reproducibility of results across different experimental systems.

How can contradictory results in phaC functional studies be reconciled?

When faced with contradictory data regarding phaC function, consider these methodological approaches:

  • Systematic variation of experimental parameters:

    • Test function across a range of pH values (5.0-8.0) rather than single points

    • Vary ion concentrations systematically to identify threshold effects

    • Consider temperature effects on transport activity

    • Examine strain-specific variations that might explain different phenotypes

  • Comprehensive genetic context analysis:

    • Investigate potential compensatory mechanisms in different genetic backgrounds

    • Perform whole-genome sequencing of adapted strains to identify suppressor mutations

    • Create double/triple mutants with related transporters to reveal functional redundancy

    • Use transcriptome analysis to identify differentially expressed genes in different strains

  • Alternative functional hypotheses testing:

    • Examine potential secondary functions beyond ion transport

    • Test involvement in stress responses rather than just homeostasis

    • Investigate protein-protein interactions that might modulate function

    • Consider post-translational modifications affecting activity

This systematic approach can reconcile apparently contradictory results by revealing context-dependent functions or identifying previously unrecognized regulatory mechanisms affecting phaC activity.

How does phaC contribute to Rhizobium meliloti stress tolerance during symbiosis?

The phaC antiporter likely contributes to bacterial stress tolerance through mechanisms including:

Understanding these functions requires integrating data from growth phenotypes, ion transport measurements, and symbiotic performance assays across various environmental conditions and genetic backgrounds.

What is the current understanding of the three-dimensional structure of phaC and its functional domains?

While a crystal structure of R. meliloti phaC is not yet available, computational and experimental approaches provide structural insights:

  • Predicted structural features:

    • Multiple transmembrane domains (typically 10-12) spanning the membrane

    • Conserved cation binding sites with aspartate and glutamate residues

    • Cytoplasmic regulatory domains responsive to pH and ion concentrations

    • Potential dimerization interfaces for functional assembly

  • Functional domains identified through mutagenesis:

    • Ion selectivity filter in transmembrane regions 4-6

    • pH sensing domain in the C-terminal cytoplasmic region

    • Regulatory phosphorylation sites modulating transport activity

    • Protein-protein interaction motifs for complex formation

  • Structural homology to related transporters:

    • Significant structural similarity to E. coli NhaA Na+/H+ antiporter

    • Conserved transport mechanism involving conformational changes

    • Similar arrangement of critical charged residues in the transport pathway

    • Shared regulatory mechanisms responding to pH and ion concentration

These structural insights guide site-directed mutagenesis strategies and provide a framework for understanding transport mechanisms and regulation.

How do genomic variations in phaC across different Rhizobium strains correlate with host specificity?

Comparative genomic analyses reveal important patterns in phaC variation:

Rhizobium StrainHost PlantKey phaC VariationsFunctional Implication
R. meliloti 1021Alfalfa (Medicago)Reference sequenceStandard K+/H+ exchange activity
R. leguminosarumPea, VetchVariations in C-terminal domainAltered regulatory properties
R. tropiciPhaseolusSubstitutions in TM domains 5-7Modified ion selectivity
Bradyrhizobium japonicumSoybeanSignificantly divergent sequencePotentially different ion specificity

These variations suggest that:

  • The core transport mechanism is conserved across species, reflecting the fundamental importance of ion homeostasis

  • Regulatory domain variations may reflect adaptation to different host environments and signaling systems

  • Ion selectivity differences could contribute to adaptation to varying soil conditions in native host ranges

  • Correlation between phaC sequence and host range suggests the antiporter may contribute to host specificity through indirect effects on bacterial physiology during nodulation

This comparative approach provides insight into the evolution of transport systems and their contribution to the establishment of specific symbiotic relationships .

What emerging technologies could advance the understanding of phaC function in Rhizobium meliloti?

Several cutting-edge technologies are poised to transform research on phaC:

  • Cryo-electron microscopy for structural determination:

    • Enables visualization of membrane proteins in near-native states

    • Can reveal conformational changes during transport cycles

    • Provides insights into protein-lipid interactions affecting function

    • Allows for structural determination without crystallization

  • Single-molecule tracking in living cells:

    • Fluorescently tagged phaC can be tracked in real-time

    • Reveals spatial distribution changes during symbiotic stages

    • Quantifies protein dynamics and clustering behavior

    • Correlates movement with cellular physiology

  • CRISPR-Cas9 base editing for precise mutagenesis:

    • Enables single nucleotide modifications without double-strand breaks

    • Allows high-throughput creation of variant libraries

    • Supports in vivo structure-function studies

    • Facilitates the study of essential gene functions through subtle modifications

  • Microfluidic devices for controlled symbiosis studies:

    • Creates defined gradients of ions and signaling molecules

    • Enables real-time monitoring of bacterial responses

    • Allows precise control of environmental conditions

    • Supports high-throughput phenotypic screening

These technologies, when applied to phaC research, promise to bridge current knowledge gaps and reveal previously inaccessible aspects of antiporter function in symbiotic contexts.

How might systems biology approaches contribute to understanding phaC in the context of symbiotic nitrogen fixation?

Systems biology offers powerful frameworks for integrating phaC function into broader biological contexts:

These integrative approaches can reveal how a single transporter like phaC contributes to the complex and dynamic process of symbiotic nitrogen fixation, potentially identifying new targets for agricultural improvements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.