Recombinant Rhizobium meliloti Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will preferentially ship the format we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
htpX; R03325; SMc04091; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
htpX
Target Protein Sequence
MNLMRTAMLLAFMTVLFMAVGYVIGGRGGMMIALVIAAGMNFFSYWNSDRMVLRMYRAQE VDEHSAPEYYGIVRDLAKNAGLPMPRVYVIDSPQPNAFATGRNPENAAVAASTGLLHSLS YEEVAGVMAHELAHIQYRDTLTMTLTATLAGAISMLGNFAFFFGGNRENNNPLGFIGVLI AMIVAPLAAMLVQMAISRTREYSADRRGAEICGNPLWLSSALRKIAGAAQVIHNNDAERN PATAHMFIINPLSGERMDNLFSTHPNTENRVAALERMARETSTGSTAPVRPDNAGRKSRS VPRTGWGRGGSEPPKGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the proposed function of HtpX proteases in bacterial cells?

HtpX proteases are primarily involved in membrane protein quality control, particularly under stress conditions. In E. coli, HtpX has been shown to eliminate malfolded and/or misassembled membrane proteins that could disrupt membrane integrity and function . This proteolytic quality control is especially important during heat stress, as suggested by the heat-inducible nature of htpX gene expression observed in Bacillus subtilis . In combination with other proteases like FtsH, HtpX helps maintain protein homeostasis in the membrane. Studies in B. subtilis have shown that the absence of both FtsH and HtpX causes severe growth defects under heat stress, suggesting partially overlapping functions in heat resistance .

How is recombinant Rhizobium meliloti Protease HtpX typically produced for research purposes?

Recombinant Rhizobium meliloti Protease HtpX homolog is typically expressed in E. coli expression systems with an affinity tag (most commonly a His-tag) to facilitate purification. The full-length protein (amino acids 1-319) is cloned into an expression vector with an N-terminal His-tag. After expression in E. coli, the protein is purified using metal affinity chromatography and often provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For experimental use, the protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

What assay systems are available for measuring HtpX protease activity in vivo?

While no specific assay system has been directly described for the Rhizobium meliloti HtpX homolog, researchers working with the E. coli HtpX have developed an in vivo protease activity assay system that could be adapted. This system uses a specifically constructed model substrate (XMS1) that enables semiquantitative and convenient detection of HtpX protease activity . The assay system allows researchers to:

  • Detect differential protease activities of wild-type versus mutant HtpX proteins

  • Assess the effects of mutations in conserved regions on protease function

  • Study the proteolytic activity under various physiological conditions

This methodology could potentially be adapted for studying the Rhizobium meliloti HtpX homolog by constructing similar model substrates that would be recognized and cleaved by the R. meliloti enzyme .

How can researchers effectively solubilize and maintain the stability of recombinant HtpX for biochemical studies?

As a membrane protease, HtpX presents challenges for biochemical characterization. Based on general practices for membrane proteins and specific information for HtpX:

  • Solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin to extract the protein from membranes while maintaining its native conformation.

  • Buffer composition: Maintain protein in Tris/PBS-based buffers at pH 8.0 with added stabilizers such as trehalose (6%) .

  • Storage conditions: Store the protein at -20°C/-80°C with 5-50% glycerol to prevent freeze-thaw damage .

  • Handling precautions: Avoid repeated freeze-thaw cycles; prepare working aliquots that can be stored at 4°C for up to one week .

  • Metal ion consideration: As a metalloprotease, ensure buffers contain appropriate concentrations of zinc ions, and avoid metal chelators like EDTA or 1,10-phenanthroline which would inhibit activity .

What methods are most effective for studying the membrane topology and active site accessibility of HtpX?

To study membrane topology and active site accessibility of HtpX proteins:

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and use membrane-permeable and -impermeable sulfhydryl reagents to determine which regions are accessible from which side of the membrane.

  • Proteolytic accessibility: Use proteases that cannot cross the membrane to determine which regions are exposed to the periplasm versus cytoplasm.

  • Fluorescence spectroscopy: Attach fluorescent probes to specific sites to monitor local environment changes that indicate membrane insertion.

  • Computational prediction: Use algorithms that predict transmembrane domains based on hydrophobicity profiles, although there remains controversy about whether all predicted transmembrane segments (especially the C-terminal regions) are actually embedded in the membrane .

  • Structural studies: While challenging for membrane proteins, techniques like cryo-EM or X-ray crystallography with the protein in detergent micelles or nanodiscs can provide detailed structural information.

How is the expression of htpX regulated in Rhizobium meliloti compared to other bacterial species?

Based on the available information, there appear to be significant differences in htpX regulation between bacterial species:

  • In Rhizobium/Sinorhizobium meliloti: The htpX gene is regulated by RpoH-type sigma factors that control global gene expression during heat shock. RpoH1 and RpoH2 have partially redundant roles, with RpoH1 being particularly important during heat shock response .

  • In Escherichia coli: The htpX gene is regulated by the CpxR/CpA two-component system, which responds to accumulation of abnormal cytoplasmic membrane proteins .

  • In Bacillus subtilis: The htpX gene is under dual negative control by the transcriptional repressors Rok and YkrK. Additionally, it is strongly heat-inducible and subject to transient negative control by SigB under heat stress .

These differences in regulatory mechanisms likely reflect adaptations to the specific ecological niches and lifestyles of each bacterial species .

What is the relationship between RpoH sigma factors and htpX expression in Sinorhizobium meliloti?

In Sinorhizobium meliloti, RpoH-type sigma factors have a significant impact on htpX expression:

  • The S. meliloti genome encodes two RpoH sigma factors, RpoH1 and RpoH2, which have partially overlapping but distinct functions .

  • An rpoH1 mutation reduces the expression of more than 300 genes during heat shock or acidic pH stress, likely including htpX .

  • The RpoH1 sigma factor is essential for effective symbiosis with leguminous plants, suggesting that proper regulation of its target genes, including potentially htpX, is critical for this process .

  • While RpoH2 shows no notable phenotypic changes when mutated individually, the rpoH1 rpoH2 double mutant shows more severe symbiotic defects than the rpoH1 single mutant, indicating partially redundant roles in controlling gene expression during symbiosis .

This regulatory mechanism differs from that in E. coli, where htpX is primarily regulated by the CpxR/CpxA two-component system .

What post-translational modifications or regulatory mechanisms affect HtpX protease activity?

While specific information about post-translational regulation of HtpX in Rhizobium meliloti is limited, several potential regulatory mechanisms can be inferred from studies of similar proteases:

  • Metal ion availability: As a zinc metalloprotease with the HEXXH motif, HtpX activity is dependent on zinc binding. Fluctuations in available zinc could regulate enzyme activity .

  • Substrate-induced activation: Some proteases remain in an inactive conformation until binding of a substrate induces conformational changes that activate the enzyme.

  • Membrane environment: Changes in membrane fluidity or composition during stress conditions may affect the conformation and activity of membrane-bound HtpX.

  • Protein-protein interactions: Interactions with other membrane proteins or components of protein quality control systems may modulate HtpX activity, similar to how HtpX in E. coli is thought to collaborate with FtsH .

  • Redox state: The cellular redox environment might affect catalytic activity through modification of critical cysteine residues, though this would need verification for HtpX specifically.

What is the role of HtpX in Sinorhizobium meliloti symbiosis with leguminous plants?

While the specific role of HtpX in S. meliloti symbiosis has not been directly established in the provided search results, we can infer its potential importance from related findings:

  • The RpoH sigma factors, which likely regulate htpX expression, play essential roles in symbiosis with leguminous plants. The rpoH1 mutant elicits nodules with no nitrogen-fixing activity (Fix- phenotype), while the rpoH1 rpoH2 double mutant is unable to form nodules at all (Nod- phenotype) .

  • Proper protein quality control in the membrane is likely critical during the transition from free-living to symbiotic lifestyle, which involves significant changes in the bacterial cell envelope and metabolism.

  • Given that iron metabolism (via the RpoH-regulated sufT gene) has been shown to be critical for effective symbiosis , and that membrane proteases like HtpX are involved in maintaining cellular protein homeostasis under stress, HtpX may contribute to adapting the bacterial membrane proteome during symbiotic interaction.

  • The protein quality control systems in S. meliloti likely need to adapt to the unique environment inside plant nodules, which includes microaerobic conditions and exposure to plant defensive compounds .

How does the function of HtpX relate to iron-sulfur cluster metabolism in Sinorhizobium meliloti?

  • The sufT gene, which is involved in iron-sulfur (Fe/S) cluster assembly, is regulated by RpoH in S. meliloti and is indispensable for effective symbiosis .

  • SufT contributes to Fe/S protein metabolism under intrinsic iron limitation exerted by RirA, a global iron regulator .

  • HtpX, as a likely member of the RpoH regulon, may indirectly affect iron-sulfur cluster metabolism by participating in the quality control of membrane proteins involved in iron transport or metabolism.

  • Disruption of protein quality control systems could potentially affect the stability or function of membrane-associated components of the iron transport or Fe/S cluster assembly machinery, indirectly impacting iron homeostasis.

This suggests a potential functional relationship between membrane protein quality control (involving HtpX) and iron-sulfur cluster metabolism in S. meliloti, though direct experimental evidence for this connection is not provided in the search results.

What phenotypes are associated with htpX mutations in various bacterial species?

The phenotypic consequences of htpX mutations vary across bacterial species:

These differential phenotypes highlight the adapted roles of HtpX in different bacterial species and their respective ecological contexts.

How conserved is the HtpX protease structure and function across different bacterial species?

HtpX is well conserved across numerous bacterial species, though with some variations in structure and regulation:

  • Structural conservation:

    • The HEXXH zinc-binding motif is highly conserved as the catalytic core of HtpX proteases

    • Multiple transmembrane segments are present in HtpX from different species, though the exact topology may vary

    • E. coli HtpX has four hydrophobic regions (H1-H4) that could act as transmembrane segments, with controversy about whether the two C-terminal regions are membrane-embedded

  • Functional conservation:

    • Across species, HtpX is generally involved in membrane protein quality control

    • In E. coli, it collaborates with FtsH to eliminate misfolded membrane proteins

    • In B. subtilis, HtpX appears to have partially overlapping functions with FtsH in heat resistance

  • Regulatory divergence:

    • In E. coli: Regulated by the CpxR/CpxA two-component system

    • In B. subtilis: Under dual negative control by Rok and YkrK repressors

    • In S. meliloti: Likely regulated by RpoH-type sigma factors

This pattern suggests that while the core proteolytic function of HtpX is conserved, its regulation has diversified to match the specific ecological niches and lifestyles of different bacterial species.

What methods can be used to investigate potential substrates of HtpX in Rhizobium meliloti?

Several experimental approaches could be employed to identify HtpX substrates in R. meliloti:

  • Comparative proteomics:

    • Compare membrane protein profiles of wild-type and htpX mutant strains using 2D gel electrophoresis or mass spectrometry

    • Identify proteins that accumulate in the htpX mutant, suggesting they might be substrates

  • In vivo substrate trapping:

    • Engineer catalytically inactive HtpX mutants (e.g., by mutating the HEXXH motif) that can still bind but not cleave substrates

    • Purify these "substrate trap" variants with their bound substrates for identification

  • Substrate model construction:

    • Develop model substrates similar to the XMS1 system used for E. coli HtpX

    • Test various membrane proteins for cleavage by purified HtpX in vitro

  • Co-immunoprecipitation:

    • Use tagged HtpX to pull down interacting proteins, which may include substrates

    • Validate potential substrates with follow-up proteolysis assays

  • Genetic suppressor screens:

    • Identify suppressor mutations that alleviate phenotypes of htpX mutations

    • These may highlight pathways connected to HtpX function, as seen with the rirA mutations that suppressed sufT phenotypes in S. meliloti

  • Targeted candidate approach:

    • Test known substrates of HtpX from other bacteria (if identified) as potential substrates in R. meliloti

How does the dual function of membrane proteases in protein quality control (assembly promotion versus degradation) apply to HtpX?

The concept of dual function in membrane proteases is exemplified by BepA (YfgC), which can both promote assembly and mediate degradation of outer membrane proteins depending on their folding state . While specific evidence for this dual functionality in HtpX is not directly presented in the search results, we can propose a model based on related findings:

  • Potential dual functionality of HtpX:

    • Primary role in degradation: HtpX likely functions primarily as a protease to eliminate misfolded or damaged membrane proteins, particularly under stress conditions

    • Potential chaperone-like function: Some proteases retain functionality when their catalytic activity is compromised, suggesting they may have non-proteolytic roles

  • Supporting evidence:

    • In BepA studies, expression of protease-active site mutants partially suppressed phenotypes of BepA deletion, suggesting functions independent of proteolytic activity

    • Similar experimental approaches could determine if HtpX also possesses functions beyond proteolysis

  • Physiological significance:

    • During normal growth, HtpX might favor a chaperone-like function to assist in membrane protein folding

    • Under stress conditions (heat shock, pH stress), it might shift toward proteolytic degradation of damaged proteins

    • This functional flexibility would allow cells to maintain membrane protein homeostasis under varying conditions

  • Research implications:

    • Investigating potential substrate-specific effects would be valuable (degradation of some substrates versus assistance in assembly of others)

    • Examining interactions between HtpX and other components of membrane protein quality control systems might reveal mechanisms of functional switching

This dual functionality model remains speculative for HtpX specifically but represents an important research direction based on findings with related membrane proteases.

What are the major challenges in studying membrane proteases like HtpX, and how can they be addressed?

Studying membrane proteases like HtpX presents several technical challenges:

  • Protein purification and solubility:

    • Challenge: Membrane proteins are difficult to extract and purify in their native conformation

    • Solution: Use mild detergents or amphipols, nanodiscs, or other membrane mimetics; optimize buffer conditions with stabilizers like trehalose

  • Determining membrane topology:

    • Challenge: Establishing the precise orientation of transmembrane segments and catalytic domains

    • Solution: Combine computational prediction with experimental approaches like cysteine scanning mutagenesis and accessibility studies

  • Identifying physiological substrates:

    • Challenge: Natural substrates may be present at low levels or processed rapidly

    • Solution: Use substrate trapping mutants, comparative proteomics, and in vivo crosslinking approaches

  • Assaying proteolytic activity:

    • Challenge: Developing assays that reflect physiological activity

    • Solution: Create model substrates similar to those developed for E. coli HtpX (XMS1) ; adapt assays for both in vitro and in vivo conditions

  • Distinguishing direct from indirect effects:

    • Challenge: Phenotypes of htpX mutations may result from complex downstream effects

    • Solution: Use acute depletion strategies rather than constitutive knockouts; perform time-course studies after inactivation

  • Species-specific differences:

    • Challenge: Findings from one bacterial species may not translate to another

    • Solution: Perform comparative studies across multiple species; identify both conserved and species-specific aspects of HtpX function

What are promising research directions for understanding HtpX function in Rhizobium meliloti symbiosis?

Future research on HtpX in R. meliloti symbiosis could explore:

  • Symbiosis-specific substrates:

    • Identify membrane proteins that are specifically processed by HtpX during symbiotic interaction with legume hosts

    • Determine if HtpX contributes to remodeling the bacterial membrane during the transition to bacteroid forms

  • Integration with other stress responses:

    • Investigate the relationship between HtpX-mediated protein quality control and other stress responses active during symbiosis

    • Examine potential crosstalk between iron metabolism (involving sufT and RirA) and membrane protein quality control

  • Redundancy and compensation:

    • Identify other proteases that may have overlapping functions with HtpX in R. meliloti

    • Determine if dual mutation of htpX with other proteases creates synthetic phenotypes during symbiosis

  • Temporal regulation:

    • Analyze the expression and activity of HtpX throughout the stages of symbiotic interaction

    • Identify potential stage-specific regulation mechanisms

  • Host plant influence:

    • Investigate whether plant-derived signals or compounds modulate HtpX activity

    • Examine HtpX function in different host plant backgrounds

  • Environmental stress factors:

    • Determine how environmental stresses that affect symbiosis (drought, salinity, pH) impact HtpX function

    • Test if htpX mutants show altered sensitivity to these stresses during symbiosis

  • Applied aspects:

    • Explore whether engineering HtpX expression or activity could enhance symbiotic efficiency under suboptimal conditions

    • Investigate potential roles in other plant-associated lifestyles of rhizobia

How might advances in structural biology techniques contribute to understanding HtpX mechanism and substrate recognition?

Recent advances in structural biology offer promising approaches for elucidating HtpX function:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.