Recombinant Rhizobium meliloti Putative cyclic beta-1,2-glucan modification protein (cgmA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cyclic Beta-1,2-Glucan Modification

cgmA catalyzes the transfer of phosphoglycerol substituents to cyclic beta-1,2-glucan backbones . These modifications confer anionic properties to the glucans, which are hypothesized to aid in:

  • Hypo-osmotic adaptation: Stabilizing membrane integrity under osmotic stress .

  • Symbiotic interactions: Facilitating bacterial entry into plant cells during nodulation .

Mutational studies reveal that Rhizobium meliloti mutants lacking cgmA (e.g., strain S9) exhibit altered glucan structures but retain nodulation efficiency and osmotic tolerance. This suggests that compensatory mechanisms (e.g., elevated succinylation) maintain anionic charge, implying that charge rather than specific substituents is critical for function .

Functional Studies

StudyKey Findings
Cyclic Glucan MutantscgmA-deficient mutants show elevated succinyl substituents, compensating for lost phosphoglycerol .
Symbiotic CompetencecgmA mutants nodulate alfalfa effectively, indicating redundancy in symbiosis .
OsmoregulationcgmA-deficient strains grow comparably to wild-type in hypo-osmotic media .

Applications in Research

  • Enzymatic Studies: Used to investigate phosphoglycerol transferase activity in vitro .

  • Structural Biology: Serves as a template for modeling related glycosyltransferases .

  • Symbiosis Research: Aids in dissecting the role of glucan modifications in plant-microbe interactions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cgmA; R01848; SMc00195; Putative cyclic beta-1,2-glucan modification protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-639
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
cgmA
Target Protein Sequence
MARIDSAVSSSQVYADGESSSARYTRTLSGARSALFTLLIAIALVFTVEVIVRWSWPDTV AYFADPMRPAWTTVAVFFLAMLGVDALFGREHKAALLIAPLAVVPAFISQQKQVFLSDPL YPTDFLFGRQIMELMPVLVKDRPWTAVGVVAGLIAAIVVGALLLRFAWQNFPKLTRRERL MRIAFALPLLVAFWNIMDYNQFSWIRDRLRVIPIMWDQTENYRHNGFALAFAINLPMANV NAPAGYMADAIDRIPVKPLPAGTTHRGKPDVIVLMSESFWDPTRLPKVKLTPDPMPTIRE LQGGNVFSPEFGGMTANVEFEALTGFSNAFLPYGSIPYQQYIRNPIPSLATFFRGEGYVS RAIHPFQGWFWNRTAVYKAFGFDMFRSEENMPAMQKRGIFASDESLTKEIIRQADEVEDP FFFFAVTLQGHGPYEANRYAKNTIKVEGDLPEADRQVLATYAQGVKEADDSLKMLMDWAK ERDRETIIVLFGDHLPPLNTVYSSTGYMKGITAERKGPKDQMKAEHETPLVVWSNKTGPK KNIGTISPAFLSYQILKQAGYEHPYYTGFLGKVYDHYRVLDRYMLIRKNGKDVADWLRQP KVPASLRDYRFLQHDMMFGKRYSTERFFKSHAELYSAGL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What structural features characterize the cgmA protein?

The cgmA protein contains domains characteristic of transferase enzymes that catalyze the addition of phosphoglycerol groups to substrate molecules. Structural analyses suggest the presence of a catalytic domain responsible for transferring phosphoglycerol from phosphatidylglycerol to the cyclic beta-1,2-glucan molecules . The protein likely contains membrane-associated regions that facilitate interaction with the periplasmic space where the cyclic glucans are located. Sequence alignments with other modification enzymes in related Rhizobiaceae species reveal conserved motifs likely involved in substrate recognition and catalysis. The three-dimensional structure prediction indicates potential binding pockets for both the donor phosphatidylglycerol and the acceptor cyclic glucan, allowing for the precise positioning required for the transfer reaction.

What are the recommended protocols for generating and isolating recombinant cgmA protein?

For recombinant expression of cgmA, a heterologous expression system using E. coli strains optimized for membrane protein expression is recommended. The protocol typically involves:

  • PCR amplification of the cgmA gene from Rhizobium meliloti genomic DNA using high-fidelity polymerase

  • Cloning into an expression vector with an inducible promoter (pET or pBAD systems)

  • Transformation into E. coli expression hosts (BL21(DE3) or derivatives)

  • Induction of protein expression at lower temperatures (16-20°C) to enhance proper folding

  • Cell lysis using either sonication or French press methods

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of the membrane-associated protein using mild detergents (DDM or CHAPS)

  • Purification via affinity chromatography (His-tag or GST-tag)

  • Further purification using ion exchange and size exclusion chromatography

For activity assays, the purified protein needs to be reconstituted with phosphatidylglycerol liposomes to provide the phosphoglycerol donor substrate. Similar methodologies have been successfully employed for related enzymes in the Rhizobiaceae family .

What analytical techniques are most effective for characterizing cgmA-modified glucans?

Multiple complementary techniques are necessary for comprehensive characterization of cgmA-modified cyclic beta-1,2-glucans:

These techniques can be applied in combination to obtain comprehensive structural information about the modifications introduced by cgmA activity.

How can researchers generate and verify cgmA mutants?

The creation and verification of cgmA mutants involve several strategic approaches:

  • Site-directed mutagenesis: For targeted modification of specific residues predicted to be involved in catalysis or substrate binding. This approach is useful for structure-function relationship studies.

  • Insertional mutagenesis: Using transposons or antibiotic resistance cassettes to disrupt the cgmA gene. This approach was historically used to generate the first cgmA mutants.

  • CRISPR-Cas9 gene editing: For precise deletion or modification of the cgmA gene without leaving marker genes, reducing potential polar effects.

  • Allelic exchange: Replacing the wild-type gene with a mutated version through homologous recombination.

Verification of mutants should include:

  • PCR verification: To confirm the presence of the intended genetic modification

  • Sequencing: To verify the exact nucleotide changes

  • RT-PCR or RNA-Seq: To assess transcriptional effects

  • Western blotting: To confirm protein expression changes

  • TLC analysis: To verify the altered cyclic beta-1,2-glucan modification pattern, specifically the absence of phosphoglycerol substituents and increased succinylation

  • Phenotypic assays: Testing growth under hypo-osmotic conditions and nodulation ability with host plants like alfalfa

What assays can measure cgmA activity in vitro?

Several assays can be employed to measure cgmA activity in vitro:

Radioisotope incorporation assay:

  • Using 14C or 32P-labeled phosphatidylglycerol as the donor substrate

  • Measuring the transfer of labeled phosphoglycerol to purified cyclic beta-1,2-glucans

  • Quantifying incorporation through scintillation counting after separation

Coupled enzyme assays:

  • Monitoring the release of diacylglycerol (the byproduct of phosphoglycerol transfer)

  • Using diacylglycerol kinase and ATP to generate phosphatidic acid

  • Measuring ATP consumption through coupled enzymatic reactions

HPLC-based assays:

  • Separating reaction products (modified cyclic glucans) from substrates

  • Quantifying the appearance of phosphoglycerol-modified glucans

  • Analyzing the kinetics of the reaction under various conditions

Fluorescence-based assays:

  • Using fluorescently labeled cyclic glucans or phosphatidylglycerol analogs

  • Monitoring changes in fluorescence properties upon modification

  • Real-time tracking of the enzymatic reaction

These assays can be adapted to study enzyme kinetics, substrate specificity, and the effects of potential inhibitors on cgmA activity.

What is the mechanistic role of cgmA in cyclic beta-1,2-glucan modification?

The cgmA protein functions as a phosphoglycerol transferase that catalyzes the transfer of phosphoglycerol moieties from phosphatidylglycerol to specific hydroxyl groups on the cyclic beta-1,2-glucan backbone. Mechanistically, this likely involves:

  • Binding of the phosphatidylglycerol donor substrate

  • Recognition of specific positions on the cyclic glucan acceptor

  • Catalysis of the transfer reaction, forming a phosphodiester bond

  • Release of the modified glucan and diacylglycerol byproduct

How does cgmA contribute to bacterial osmotic adaptation?

  • Water retention in the periplasm during hypo-osmotic stress

  • Ion sequestration and buffering in the periplasmic space

  • Membrane stabilization through interaction with membrane components

  • Regulation of periplasmic solute concentration

Despite the lack of phosphoglycerol modifications in cgmA mutants, they grow as well as wild-type cells in hypo-osmotic media, suggesting functional redundancy with other modifications, particularly succinylation . This redundancy highlights the evolutionary importance of maintaining appropriate periplasmic osmotic properties, with the system adapting to ensure survival even when specific modification pathways are disrupted.

What is the relationship between cgmA and host-specific nodulation processes?

While direct evidence for cgmA's specific role in host-specific nodulation is limited, it functions within the broader context of Rhizobium-legume symbiosis. The cyclic beta-1,2-glucans that cgmA modifies are important for successful plant infection . The relationship between cgmA and nodulation can be understood through several aspects:

  • Signal conditioning: The phosphoglycerol modifications may influence how bacterial signals are perceived by different host plants

  • Membrane properties: Modified glucans affect bacterial membrane properties during infection thread formation and progression

  • Defense suppression: Anionic glucans may interact with plant defense systems, potentially suppressing or modulating immune responses

  • Environmental adaptation: Modifications help bacteria adapt to the changing environment during the infection process

Interestingly, while distinct from cyclic glucans, Rhizobium meliloti also produces Nod factors, which are sulfated N-acetylglucosamine oligosaccharides with varying degrees of specificity for different host plants . This suggests that R. meliloti employs multiple carbohydrate-based signaling systems with different modifications to optimize interactions with host plants under various conditions.

How do cgmA-modified glucans differ from other bacterial polysaccharides involved in plant-microbe interactions?

Cyclic beta-1,2-glucans modified by cgmA represent a distinct class of bacterial polysaccharides with unique structural and functional characteristics:

FeaturecgmA-modified GlucansNod FactorsExopolysaccharides (EPS)Lipopolysaccharides (LPS)
StructureCyclic β-1,2-linked glucose rings with phosphoglycerol and succinyl modificationsLinear β-1,4-linked N-acetylglucosamine oligomers with sulfate, acyl chainsLinear or branched heteropolysaccharidesCore oligosaccharide + O-antigen
LocationPeriplasmSecretedExtracellularOuter membrane
Primary functionOsmotic adaptationRoot hair deformation, nodule initiationBiofilm formation, infection threadMembrane integrity, defense evasion
Host specificityLimitedHighModerateModerate
ModificationsPhosphoglycerol, succinylSulfate, acetyl, acyl chainsAcetyl, pyruvyl, succinylVarious sugars, phosphate

The phosphoglycerol-modified cyclic glucans differ from Nod factors, which contain a sulfate group bound to the reducing glucosamine and either a C(16:2) or C(16:3) acyl chain attached to the nonreducing end . While Nod factors show high host specificity and directly trigger nodulation processes, cgmA-modified glucans play a more supportive role in osmotic adaptation and general plant infection processes. This complementarity between different carbohydrate-based signals may allow Rhizobium to establish successful symbiosis with multiple host plants or under varying environmental conditions .

What are the current hypotheses regarding structure-function relationships in cgmA?

Current hypotheses regarding structure-function relationships in cgmA center around several key aspects:

  • Catalytic domain architecture: Based on sequence similarity with other transferases, cgmA likely contains a catalytic domain with conserved residues involved in phosphoglycerol binding and transfer. Researchers hypothesize that specific histidine and aspartate residues form a catalytic triad essential for the transferase activity.

  • Substrate recognition mechanisms: The enzyme must specifically recognize both phosphatidylglycerol and cyclic beta-1,2-glucans. Current models suggest separate binding pockets for each substrate, with specificity determined by both shape complementarity and electrostatic interactions.

  • Membrane association: As the phosphatidylglycerol substrate is membrane-embedded, cgmA likely contains hydrophobic regions that facilitate membrane interaction without full integration, allowing it to access its lipid substrate while remaining active in the periplasmic space.

  • Regulation of activity: Post-translational modifications may regulate cgmA activity in response to environmental conditions. Phosphorylation sites have been predicted that could modulate enzyme activity depending on osmotic conditions or developmental stage of symbiosis.

  • Protein-protein interactions: cgmA may interact with other components of the glucan modification machinery. Co-immunoprecipitation studies could reveal these interaction partners and help understand the coordinated regulation of different modification pathways.

How does phosphoglycerol transfer by cgmA influence bacterial membrane properties?

The phosphoglycerol transfer activity of cgmA has several proposed effects on bacterial membrane properties:

  • Periplasmic osmolarity regulation: The anionic phosphoglycerol-modified glucans influence water retention in the periplasm, helping maintain appropriate turgor pressure across the membrane in hypo-osmotic environments.

  • Membrane phospholipid homeostasis: By utilizing phosphatidylglycerol as a substrate, cgmA may indirectly influence membrane phospholipid composition and turnover, potentially affecting membrane fluidity and curvature.

  • Cation bridging effects: The negatively charged phosphoglycerol groups can coordinate divalent cations like Mg²⁺ and Ca²⁺, which may bridge between modified glucans and membrane phospholipids, stabilizing membrane structures.

  • Periplasmic protein interactions: Modified glucans may interact with periplasmic proteins involved in cell envelope biogenesis and maintenance, indirectly affecting membrane organization.

  • Response to membrane stress: Under conditions of membrane stress, the activity of cgmA may be modulated to adjust the properties of cyclic glucans and help maintain membrane integrity.

What genomic and proteomic approaches are advancing our understanding of cgmA regulation?

Modern genomic and proteomic approaches are providing new insights into cgmA regulation:

  • Transcriptomic profiling: RNA-Seq analysis under various environmental conditions (osmotic stress, symbiotic stages, nutrient limitation) has revealed the transcriptional regulation patterns of cgmA. These studies help identify the conditions that trigger cgmA expression and the regulatory networks involved.

  • Chromatin immunoprecipitation (ChIP-seq): This technique identifies transcription factors that bind to the cgmA promoter region, elucidating the direct regulators of gene expression.

  • Proteomics of membrane-associated complexes: Mass spectrometry-based analysis of membrane-associated protein complexes can identify interaction partners of cgmA, providing insights into its integration within larger functional complexes.

  • Phosphoproteomics: Analysis of phosphorylation patterns of cgmA under different conditions helps understand post-translational regulation of enzyme activity.

  • Genetic interaction screens: High-throughput screening for synthetic phenotypes when cgmA mutations are combined with other genetic perturbations helps place cgmA in broader functional networks.

  • Comparative genomics: Analysis of cgmA conservation, synteny, and evolution across related species provides insights into its evolutionary importance and potential co-evolution with other components of the glucan modification system.

The development of high-density physical maps of the S. meliloti genome has facilitated these approaches by providing precise positional information for cgmA and surrounding genetic elements . These integrated approaches are revealing complex regulatory networks that coordinate cgmA expression and activity with other aspects of bacterial physiology and symbiotic development.

How do environmental factors modulate cgmA activity and expression?

Environmental factors significantly influence cgmA activity and expression through multiple mechanisms:

  • Osmotic stress response: As cyclic beta-1,2-glucans are involved in hypo-osmotic adaptation, osmotic conditions likely modulate cgmA expression and activity. Research suggests increased expression under hypo-osmotic conditions when the need for periplasmic glucans is highest.

  • Plant signal sensing: Plant-derived flavonoids and other signals encountered during symbiosis may trigger changes in cgmA expression as part of the broader symbiotic program.

  • Nutrient availability: Phosphate limitation may influence cgmA activity by affecting the availability of phosphatidylglycerol substrate and potentially triggering alternative modification pathways.

  • pH fluctuations: As bacteria move from soil to the rhizosphere and eventually to the nodule environment, they encounter pH changes that may affect cgmA expression and enzymatic activity.

  • Oxygen tension: The transition to the low-oxygen environment of the nodule likely triggers metabolic reprogramming that includes changes in membrane composition and potentially cgmA regulation.

  • Temperature variations: Soil temperature fluctuations can affect enzyme activity and expression, with potential adaptation mechanisms to maintain functional modification at different temperatures.

Experimental data indicates that despite the absence of phosphoglycerol modifications in cgmA mutants, they maintain normal growth under hypo-osmotic conditions and effective nodulation capabilities . This suggests robust compensatory mechanisms that ensure glucan function even when specific modification pathways are compromised, highlighting the evolutionary importance of these molecules.

How can researchers address variability in phenotypes observed in cgmA mutants?

Variability in cgmA mutant phenotypes is a common challenge that requires systematic approaches to resolve:

  • Standardize growth conditions: Minor variations in media composition, temperature, or growth phase can significantly affect phenotype expression. Establish strict protocols for culture conditions and growth monitoring.

  • Consider compensatory mechanisms: The observed increase in succinyl substituents in cgmA mutants demonstrates that compensatory modifications can mask phenotypes . Analyze all possible modifications simultaneously using comprehensive analytical techniques.

  • Create double/triple mutants: Generate mutants lacking multiple modification pathways to overcome redundancy. For example, combining cgmA mutations with genes involved in succinylation may reveal phenotypes not apparent in single mutants.

  • Quantify modification levels: Use quantitative analytical methods (HPLC, MS) to precisely measure the levels of different modifications rather than relying on presence/absence determinations.

  • Monitor environmental parameters: Systematically vary osmolarity, pH, and temperature to identify conditions where phenotypic differences become apparent.

  • Use sensitive assays: Standard growth curves may not capture subtle differences. Consider competition assays, microfluidic single-cell analysis, or stress recovery measurements that can reveal fitness differences not apparent in monoculture.

  • Examine plant interactions quantitatively: Beyond nodulation presence/absence, measure infection efficiency, nodule development timing, nitrogen fixation rates, and competitive fitness during plant colonization.

When properly controlled, these approaches can resolve apparent contradictions in phenotypic data and provide more nuanced understanding of cgmA function.

What are common pitfalls in recombinant cgmA expression systems?

Researchers working with recombinant cgmA expression systems should be aware of several common pitfalls:

  • Protein misfolding and aggregation: As a protein likely involved in membrane interactions, cgmA may be prone to misfolding when overexpressed. Symptoms include inclusion body formation and low recovery of active protein.

    • Solution: Express at lower temperatures (16-20°C), use specialized E. coli strains designed for membrane proteins, and consider fusion tags that enhance solubility.

  • Loss of enzymatic activity: Purified protein may show reduced or absent activity despite successful expression.

    • Solution: Ensure appropriate cofactors are present, verify that the substrate preparation (particularly phosphatidylglycerol) is active, and consider including membrane mimetics during purification.

  • Substrate accessibility issues: If cgmA requires correct orientation relative to a membrane for activity, typical in vitro assay configurations may not support activity.

    • Solution: Reconstitute the protein in liposomes containing phosphatidylglycerol to provide a more native-like environment.

  • Expression host effects: E. coli may lack regulatory factors or post-translational modifications required for cgmA activity.

    • Solution: Consider expression in closer relatives like Agrobacterium or develop cell-free expression systems using Rhizobium extracts.

  • Tag interference: Affinity tags may disrupt protein folding or active site accessibility.

    • Solution: Compare N-terminal and C-terminal tagged versions, include cleavable tags, and verify activity after tag removal.

  • Improper storage conditions: Purified cgmA may lose activity during storage.

    • Solution: Test stability under various storage conditions (temperature, buffer composition, glycerol percentage) and use activity assays to determine optimal preservation methods.

By anticipating these challenges, researchers can design expression and purification strategies that maximize the yield of functional protein.

How should researchers approach contradictory findings in cgmA functional studies?

When faced with contradictory findings in cgmA research, a systematic approach can help resolve discrepancies:

  • Examine methodological differences: Carefully compare experimental conditions, strains, and analytical methods used in conflicting studies. Minor differences in growth conditions or analytical sensitivity can lead to apparently contradictory results.

  • Consider genetic background effects: The presence of suppressor mutations or strain-specific differences can influence phenotypes. Sequence verify strains and consider transferring mutations to multiple genetic backgrounds.

  • Evaluate redundancy and compensation: As seen with increased succinylation compensating for lack of phosphoglycerol modification in cgmA mutants , functional redundancy can mask phenotypes. Look for evidence of compensatory changes in contradictory studies.

  • Implement combinatorial approaches: Combine genetic, biochemical, and structural analyses to build a more complete picture. Single-approach studies may miss important aspects of cgmA function.

  • Standardize quantification methods: Ensure that modifications are being measured using comparable techniques with appropriate controls and standards. Quantitative differences can sometimes be misinterpreted as qualitative contradictions.

  • Develop clear phenotypic assays: The lack of clear growth phenotypes in cgmA mutants under standard conditions suggests the need for more sensitive or specific assays to detect functional differences.

  • Collaborate across research groups: Direct collaboration between labs reporting contradictory results can help identify and resolve methodological differences through standardized protocols and shared materials.

What statistical approaches are recommended for analyzing cgmA activity data?

Appropriate statistical analysis is crucial for interpreting cgmA activity data reliably:

  • Enzyme kinetics analysis:

    • For in vitro activity assays, apply Michaelis-Menten kinetics to determine Km and Vmax parameters

    • Use non-linear regression rather than linearization methods (e.g., Lineweaver-Burk plots)

    • Compare kinetic parameters across different conditions using extra sum-of-squares F test

  • Modification quantification:

    • For analysis of glucan modifications, use appropriate normalization to total glucan content

    • Apply multivariate analysis to simultaneously analyze multiple modification types

    • Consider principal component analysis to identify patterns in modification profiles

  • Growth and phenotypic data:

    • Use mixed-effects models for time course data to account for repeated measurements

    • Apply non-parametric tests when assumptions of normality are violated

    • Calculate area under the curve for growth curves rather than comparing individual time points

  • Plant interaction studies:

    • Use generalized linear mixed models for nodulation data, which often follow non-normal distributions

    • Account for plant-to-plant variability as a random effect

    • Consider survival analysis approaches for time-to-nodulation data

  • Sample size considerations:

    • Perform power analysis to determine appropriate sample sizes

    • Report effect sizes along with p-values

    • Consider biological significance beyond statistical significance

  • Data visualization:

    • Use appropriate error bars (standard deviation for descriptive statistics, standard error or confidence intervals for inferential statistics)

    • Consider density plots or violin plots for distribution visualization

    • Use color-coding consistently across different data presentations

These statistical approaches, when properly applied, enhance the reliability and interpretability of experimental data related to cgmA function and cyclic beta-1,2-glucan modifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.