Recombinant Rhizobium meliloti Sensor protein ChvG (chvG)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Rhizobium meliloti sensor protein ChvG (chvG) is a sensor protein that belongs to a two-component regulatory system in Rhizobium meliloti . This system plays a crucial role in regulating the production of succinoglycan, which is vital for the symbiotic relationship between Rhizobium meliloti and its host plant . ChvG is a histidine kinase sensor protein located in the cytoplasmic membrane . It shares significant homology with Agrobacterium tumefaciens ChvG and Brucella abortus BvrS, which are essential for the pathogenicity of their respective hosts .

Function and Structure

ChvG is a sensor histidine kinase protein with conserved protein sequence signatures, indicating its role as a histidine kinase sensor protein . Computer analysis predicts that ExoS is a membrane protein with two transmembrane domains: one near the N-terminus and another in the middle of the protein . Agrobacterium tumefaciens ChvG has an N-terminal periplasmic domain and a C-terminal cytoplasmic domain . It is proposed that ExoS has a similar membrane topology . The cytoplasmic domain of ExoS exhibits kinase activity .

Role in Succinoglycan Production

The exoS gene, which encodes the sensor of the ExoS/ChvI two-component regulatory system, and the exoR gene are involved in regulating both succinoglycan and flagellum biosynthesis . Mutants of S. meliloti, such as exoR95::Tn5 and exoS96::Tn5, were isolated due to their ability to overproduce succinoglycan . The A. tumefaciens chvG gene can suppress the elevated, constitutive level of succinoglycan synthesis observed in an exoS96 mutant, suggesting that the R. meliloti ExoS and A. tumefaciens ChvG proteins are functionally interchangeable in R. meliloti cells .

Regulation of Flagellum Biosynthesis

The ExoS/ChvI two-component regulatory system is involved in the regulation of flagellum biosynthesis . S. meliloti uses two to eight peritrichous semirigid flagella for cellular motility, which is essential for movement in viscous liquids . The genes responsible for chemotaxis, flagellum, and motility are tightly regulated in a hierarchical order from class I to class III . Any loss or change of gene function in this hierarchy can result in reduced cellular motility, which in turn reduces nodulation efficiency .

Homology and Functional Interchangeability

R. meliloti ExoS and A. tumefaciens ChvG share a high level of homology, suggesting a functional relationship . The A. tumefaciens chvG gene can suppress the elevated, constitutive level of succinoglycan synthesis observed in an exoS96 mutant . Only the uninterrupted R. meliloti exoS gene can suppress the mutant phenotype of the A. tumefaciens chvG mutant, which is sensitive to complex growth media . The R. meliloti chvI gene can suppress the A. tumefaciens chvI mutant, indicating that heterologous pairs of sensors and response regulators from the two organisms can interact effectively .

Table of S. meliloti Strains

StrainRelevant Characteristics
Rm1021Wild-type strain
MT616(pRK600)Helper for conjugation
exoY210::Tn5Succinoglycan-deficient mutant (control)
exoR95::Tn5Succinoglycan overproduction mutant
exoS96::Tn5Succinoglycan overproduction mutant; might result in the formation of a constitutively active version of the sensor .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
chvG; exoS; R00043; SMc04446; Sensor protein ChvG; Histidine kinase sensory protein ExoS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-577
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
chvG
Target Protein Sequence
MRGQRRWAHPFTLIRRLFGNAVFSSLTRRIVFFNLVALVVLVGGIMYLNQFREGLIDARV ESLLTQGEIIAGAISASASVDTNSITIDPEKLLELQAGESITPLPSDEDLEFPIIQERVA PVLRRLISPTRTRARLFDADADLLLDSRHLYSGGQVLRFDLPPVDPESPSLADEFGTWFN RLLQPGDLPLYKEPPGGNGSIYPEVMNALTGVRGAVVRVTEKGELIVSVAVPVQRFRAVL GVLLLSTQAGDIDKIVHAERLAIIRVFGVAALVNVILSLLLSSTIANPLRRLSAAAIRVR RGGAKEREEIPDFSSRQDEIGNLSVALREMTTALYDRIAAIENFAADVSHELKNPLTSLR SAVETLPLARNEESKKRLMDVIQHDVRRLDRLISDISDASRLDAELARADAKKVDLEKLL GDLVEISRQIRGSKKPVLLDFVVDRKDNPRASFIVSGYELRIGQIITNLIENARSFVPEQ NGRIVVRLTRSRLRCIVYVEDNGPGIQAEDIDRIFERFYTDRPEGEDFGQNSGLGLSISR QIAEAHGGTLRAENIAGKDGRISGARFVLSLPAGPHP
Uniprot No.

Target Background

Function
ChvG (ExoS), a member of a two-component regulatory system (ChvG/ChvI), regulates succinoglycan production in *Rhizobium meliloti*. It activates ChvI through phosphorylation.
Gene References Into Functions
  1. This study utilized a merodiploid-facilitated strategy to isolate *exoS* and *chvI* null mutants, demonstrating the essentiality of the *S. meliloti* ExoS/ChvI two-component regulatory system for symbiosis with alfalfa. PMID: 19843226
  2. ExoR, a novel periplasmic inhibitor of two-component signaling, binds to ExoS in the *S. meliloti* periplasm to inhibit ExoS/ChvI activity. PMID: 18631237
  3. This research showed that ChvI directly binds to the intergenic regions upstream of *ropB1*, SMb21440, and SMc01580. PMID: 19749054
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rhizobium meliloti ChvG protein and what is its primary function?

The ChvG protein (also known as ExoS) is a sensor histidine kinase that forms part of the ExoS/ChvI two-component regulatory system in Rhizobium meliloti. This membrane-bound protein plays a critical role in regulating succinoglycan production, which is essential for establishing symbiosis between R. meliloti and its host plant, alfalfa . The protein contains the four conserved signature sequence patterns (H, N, D/F, and G boxes) that are characteristic of sensor histidine kinases . As the sensor component, ChvG detects environmental signals and transduces them via phosphorylation to the response regulator ChvI, which in turn modulates the expression of target genes .

How is the ExoS/ChvI two-component system structurally organized?

The ExoS/ChvI two-component regulatory system consists of two primary proteins:

ComponentLocationFunctionKey Domains
ChvG (ExoS)Cytoplasmic membraneSensor histidine kinaseTransmembrane, histidine kinase domains with H, N, D/F, and G boxes
ChvICytoplasmResponse regulatorDNA-binding domain

The ChvG protein cofractionates with membrane proteins, suggesting its location in the cytoplasmic membrane. The cytoplasmic histidine kinase domain of ExoS autophosphorylates at a histidine residue in the presence of ATP, while ChvI is phosphorylated only when the histidine kinase domain of ExoS is present . The genes encoding these proteins are located adjacent to each other, with the chvI homolog positioned just upstream of the R. meliloti exoS gene .

What phenotypes are associated with mutations in the chvG/exoS gene?

Mutations in the chvG/exoS gene result in several distinct phenotypes:

  • The exoS96::Tn5 mutation causes upregulation of succinoglycan biosynthetic genes, resulting in overproduction of succinoglycan

  • Loss of chvG function in Rhizobium leguminosarum leads to defective nodulation, acid sensitivity, and inability to grow on complex media

  • Mutations affect cell envelope integrity and stability

  • Alterations in outer membrane composition and stability, resulting in increased sensitivity to detergents, hydrophobic antibiotics, and hydrogen peroxide

  • Reduced expression of ropB, which contributes to outer membrane stability

What are the most effective methods for expressing and purifying recombinant ChvG protein?

For effective expression and purification of recombinant ChvG protein:

  • Expression Systems: The cytoplasmic histidine kinase domain of ExoS can be effectively expressed in Escherichia coli . Commercial preparations are available using E. coli, yeast, baculovirus, or mammalian cell expression systems .

  • Purification Protocol:

    • Express the protein with an appropriate tag (His-tag is commonly used)

    • Lyse cells under native conditions

    • Purify using affinity chromatography

    • Achieve ≥85% purity as determined by SDS-PAGE

  • Storage Conditions: Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week. Avoid repeated freezing and thawing .

  • Functional Assessment: Verify protein activity by testing autophosphorylation in the presence of ATP and ability to phosphorylate the ChvI protein .

How can researchers design experiments to study ChvG-ChvI signaling pathways?

To effectively study the ChvG-ChvI signaling pathway:

  • Genetic Approaches:

    • Generate targeted mutations in the chvG gene using lambda integrase recombination methods adapted for S. meliloti

    • Create deletion mutations using Flp recombinase target (FRT) sequences integrated into the genome

    • Employ epitope tagging (e.g., HA-tag) for in vivo detection and chromatin immunoprecipitation

  • Protein-Protein Interaction Studies:

    • Express and purify both the histidine kinase domain of ChvG and the ChvI protein

    • Conduct in vitro phosphorylation assays to demonstrate signal transduction

    • Analyze protein interactions using techniques such as co-immunoprecipitation

  • Gene Expression Analysis:

    • Use chromatin immunoprecipitation followed by microarray analysis (ChIP-chip) to identify DNA regions bound by ChvI protein in vivo

    • Employ quantitative RT-PCR to validate ChvI-dependent expression in wild-type and mutant strains

    • Compare gene expression profiles between wild-type, chvI partial loss-of-function, and gain-of-function mutants

  • Experimental Design Considerations:

    • Use completely randomized design (CRD) when experimental units are homogeneous

    • Include appropriate controls (wild-type strains, vector-only controls)

    • Perform multiple independent replicates (minimum 3-5) to ensure statistical validity

What methods can be used to identify direct targets of the ChvG-ChvI system?

To identify direct targets of the ChvG-ChvI regulatory system:

  • ChIP-chip Analysis:

    • Replace the native chvI gene with an epitope-tagged version (e.g., ChvI-HA)

    • Perform chromatin immunoprecipitation to isolate DNA regions bound by ChvI

    • Hybridize immunoprecipitated DNA to microarrays covering the entire genome

    • Compare to appropriate controls (untagged ChvI strain, total DNA)

  • Consensus Sequence Identification:

    • Analyze upstream sequences of ChvI target genes to identify a consensus binding site

    • Validate the "ChvI box" using electrophoretic mobility shift assays (EMSA)

    • Confirm functionality with transcriptional fusion experiments

  • Transcriptional Profiling:

    • Compare gene expression in wild-type, loss-of-function, and gain-of-function mutants

    • Use qRT-PCR to validate differential expression of candidate target genes

    • Distinguish direct from indirect targets through integration with ChIP data

This approach has successfully identified 64 direct ChvI target genes, including exoY, rem, and chvI itself, along with a 15 bp-long consensus sequence important for ChvI binding .

How can functional complementation assays be designed to study ChvG activity and homology?

Functional complementation assays provide valuable insights into protein function and evolutionary conservation:

  • Cross-species Complementation:

    • Introduce the A. tumefaciens chvG gene into R. meliloti exoS96 mutant

    • Assess restoration of wild-type phenotypes (succinoglycan production)

    • Evaluate the effects of intact versus interrupted genes

  • Experimental Protocol:

    • Clone the chvG/exoS gene from the donor species

    • Create control constructs with interrupted genes

    • Transform or conjugate plasmids into recipient mutant strains

    • Measure phenotypic restoration (e.g., succinoglycan production on plates)

    • Include appropriate controls (empty vector, wild-type strain)

  • Interpretation:
    Successful complementation indicates functional conservation. For example, A. tumefaciens chvG can suppress elevated succinoglycan synthesis in R. meliloti exoS96 mutant, demonstrating that these proteins are functionally interchangeable . Similarly, R. meliloti exoS can complement A. tumefaciens chvG mutants, restoring growth on complex media .

What approaches can be used to investigate the role of ChvG in symbiotic relationships?

To investigate the role of ChvG in symbiosis:

  • Plant Nodulation Assays:

    • Inoculate host plants (e.g., alfalfa) with wild-type and chvG mutant strains

    • Assess nodulation efficiency, nitrogen fixation capacity, and competitiveness

    • Evaluate bacterial colonization and invasion of plant roots

  • Gene Expression During Symbiosis:

    • Create reporter gene fusions (e.g., lacZ) to monitor chvG/exoS expression

    • Analyze expression at different stages of symbiotic interaction

    • Compare expression in free-living bacteria versus bacteroids within nodules

  • Microscopy and Imaging:

    • Use fluorescently-tagged bacteria to visualize infection and nodule formation

    • Compare wild-type and mutant strains for differences in infection thread formation

    • Examine bacteroid differentiation in mature nodules

  • Metabolic Analysis:

    • Investigate changes in succinoglycan production in response to plant signals

    • Assess the relationship between ChvG signaling and bacterial metabolism during symbiosis

    • Analyze the connection between ChvG regulation and nutrient utilization

How does the ChvG-ChvI system interact with other regulatory networks in bacterial adaptation?

The ChvG-ChvI system interacts with multiple regulatory networks:

  • Integration with Stress Response Pathways:

    • The ChvG-ChvI system responds to acid stress and other environmental conditions

    • Significant overlap exists between ChvI targets and genes responding to acid stress and antimicrobial peptide treatment

    • ChvG mutants in R. leguminosarum show sensitivity to detergents, hydrophobic antibiotics, and hydrogen peroxide

  • Coordination with ExoR:

    • ExoR functions as a negative regulator of the ExoS/ChvI system

    • ExoR-ExoS-ChvI form a regulatory circuit that responds to environmental signals

    • Mutations in exoR alter expression of hundreds of genes, similar to exoS mutations

  • Experimental Approaches to Study Network Interactions:

    • Compare transcriptomes of mutants in different regulatory systems

    • Perform epistasis analysis with double mutants

    • Use ChIP-seq to identify overlapping binding sites for different regulators

    • Employ network analysis tools to integrate different datasets

  • Effects on Cellular Physiology:
    The ChvG-ChvI system independently and coordinately regulates:

    • Cellular metabolism

    • Cell envelope structure

    • Exopolysaccharide production

    • Motility

    • Stress responses

What are common challenges in working with recombinant ChvG protein and how can they be addressed?

Researchers may encounter several challenges when working with recombinant ChvG:

  • Protein Solubility Issues:

    • Challenge: Membrane proteins like ChvG often have solubility problems

    • Solution: Express only the cytoplasmic histidine kinase domain for better solubility

    • Alternative: Use detergents for full-length protein solubilization

  • Maintaining Protein Activity:

    • Challenge: Loss of enzymatic activity during purification

    • Solution: Include stabilizing agents (glycerol, reducing agents) in buffers

    • Validation: Test autophosphorylation activity with ATP to confirm functionality

  • Expression System Selection:

    • Challenge: Low expression levels in bacterial systems

    • Solution: Test multiple expression systems (E. coli, yeast, baculovirus, mammalian cells)

    • Optimization: Adjust induction conditions, temperature, and culture media

  • Protein Storage and Stability:

    • Challenge: Protein degradation and activity loss during storage

    • Solution: Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Best Practice: Create small working aliquots to avoid repeated freeze-thaw cycles

How can researchers address inconsistencies in ChvG-ChvI signaling pathway studies?

When facing inconsistencies in research findings:

  • Strain Background Differences:

    • Different R. meliloti/S. meliloti strains may show varying phenotypes

    • Ensure experiments use well-documented strains and include proper controls

    • Consider whole-genome sequencing to identify strain-specific variations

  • Experimental Condition Variability:

    • Growth conditions significantly affect two-component system signaling

    • Standardize media composition, pH, temperature, and growth phase

    • Document all experimental conditions in detail for reproducibility

  • Mutation Type Considerations:

    • Different mutation types (null, partial loss-of-function, gain-of-function) produce distinct phenotypes

    • The exoS96::Tn5 mutation produces an N-terminal truncated derivative of ExoS with altered function

    • Specify the exact nature of mutations used in each study

  • Analytical Methods Integration:

    • Combine multiple approaches (genetics, biochemistry, transcriptomics)

    • Use both in vivo (ChIP-chip) and in vitro (EMSA) methods to validate results

    • Apply statistical analysis to determine significance of observed differences

What controls are essential when studying ChvG function in experimental systems?

Essential controls for ChvG research include:

  • Genetic Controls:

    • Wild-type parental strain

    • Vector-only transformants

    • Complemented mutant strains

    • Strains with interrupted/inactive versions of the complementing gene

  • Protein Activity Controls:

    • Heat-inactivated protein preparations

    • Reactions without ATP for phosphorylation studies

    • Purified cytoplasmic domain vs. full-length protein comparisons

  • Experimental Design Controls:

    • Multiple biological replicates (minimum 3-5)

    • Technical replicates to assess method reliability

    • Appropriate randomization of treatments using complete randomized design (CRD)

  • Symbiosis Study Controls:

    • Uninoculated plants

    • Plants inoculated with known symbiotic mutants

    • Mixed inoculations to assess competitive ability

    • Plants grown under different nitrogen regimes

What are promising approaches for engineering ChvG-ChvI signaling for enhanced symbiotic efficiency?

Future engineering approaches may include:

  • Targeted Protein Engineering:

    • Modify the sensor domain of ChvG to alter sensitivity to environmental signals

    • Engineer ChvI to optimize binding to target promoters

    • Create synthetic signaling pathways with novel input-output relationships

  • Pathway Optimization Strategies:

    • Fine-tune expression levels of ExoR, ExoS, and ChvI to optimize symbiotic efficiency

    • Modify ChvI binding sites in target gene promoters to enhance or repress expression

    • Create synthetic regulatory circuits incorporating the ChvG-ChvI system

  • Experimental Validation Methods:

    • Compare engineered strains with wild-type in plant growth promotion assays

    • Measure nitrogen fixation efficiency under various environmental conditions

    • Assess competitive ability and persistence in soil environments

  • Integration with Other Symbiotic Systems:

    • Transfer optimized ChvG-ChvI systems to related rhizobial species

    • Engineer coordinated regulation with Nod factor production and nitrogen fixation

    • Develop strains with enhanced tolerance to environmental stresses

How might new technologies advance our understanding of ChvG-ChvI signaling dynamics?

Emerging technologies will drive new insights into ChvG-ChvI signaling:

  • Single-Cell Analysis:

    • Track signal transduction in individual bacterial cells using fluorescent reporters

    • Monitor population heterogeneity in ChvG-ChvI activation

    • Correlate signaling activity with symbiotic outcomes at the single-cell level

  • Structural Biology Approaches:

    • Cryo-EM and X-ray crystallography to determine three-dimensional structures

    • Structure-guided mutagenesis to identify critical functional residues

    • Molecular dynamics simulations to model signal transduction mechanisms

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop computational models of ChvG-ChvI regulatory networks

    • Identify metabolic changes associated with ChvG-ChvI activation

  • In Planta Imaging and Analysis:

    • Real-time imaging of signaling dynamics during root colonization

    • Spatiotemporal analysis of ChvG-ChvI activity during nodule development

    • Correlative microscopy connecting bacterial signaling with plant responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.