Recombinant Rhizobium meliloti sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium meliloti sn-Glycerol-3-Phosphate Transport System Permease Protein ugpA (ugpA)

The recombinant Rhizobium meliloti sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA) is a component of an ATP-binding cassette (ABC) transporter system that facilitates the uptake of sn-glycerol-3-phosphate (G3P), a key metabolite for phospholipid synthesis and phosphate acquisition. This protein is critical for bacterial adaptation to nutrient-limited environments, particularly in rhizobia like Rhizobium meliloti, which form symbiotic relationships with legumes.

Gene and Protein Information

  • Gene Name: ugpA (RB0403, SMb20417 in R. meliloti)

  • Uniprot ID: Q92WD8 (for R. meliloti strain 1021)

  • Protein Length: Full-length (1–293 amino acids) or partial variants

  • Sequence Features:

    • N-terminal: His-tag for purification (e.g., N-terminal 6xHis-tag)

    • Core Domains: Hydrophobic regions for membrane integration and ATP-binding motifs

    • AA Sequence: Includes motifs for substrate translocation (e.g., MQRVVFPNKILPYLLVAPQIVLTIVFFFWPASQALYQSVIREDPFGLKSGFVGFANFSAV...)

ParameterValue
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
Purity≥85% (SDS-PAGE)
TagsHis-tag (N-terminal)
Storage BufferTris-based buffer with glycerol (50%)
Storage Conditions-20°C to -80°C

Mechanism of Action

ugpA functions as a permease within the G3P transport system, working with:

  1. Periplasmic Binding Protein (ugpB): Binds G3P in the periplasm.

  2. ATPase Subunit (ugpC): Couples ATP hydrolysis to transport.

  3. Membrane Components (ugpA/ugpE): Facilitate substrate translocation across the membrane .

Substrate Specificity and Regulation

  • Substrate: sn-Glycerol-3-phosphate (G3P)

  • Regulation: Induced under phosphate starvation or via the pho regulon

  • Transport Efficiency:

    • High Affinity: Preferentially transports G3P over other phosphates

    • Phosphate Source: G3P can serve as a phosphate source when glucose is unavailable

Key Studies

  1. Functional Exchangeability with Homologs:

    • UgpC (ATPase) from E. coli can complement malK mutants, demonstrating conserved ATP-binding mechanisms .

    • ugpA shares structural homology with other ABC permeases (e.g., MalE in E. coli) .

  2. Role in Symbiosis:

    • R. meliloti uses G3P for phospholipid synthesis in nodules, though ugpA mutants retain symbiotic competence due to redundant systems (e.g., agl for α-glucosides) .

  3. Commercial Production:

    • Recombinant ugpA is used in structural studies, high-throughput screening for transporter inhibitors, and biotechnological applications (e.g., biofuel production) .

Comparative Analysis with Homologs

OrganismKey DifferencesShared Features
E. coli (UgpA)Lower G3P transport efficiency; requires additional components for full activityABC transporter architecture; ATP-dependent transport
Shigella flexneriPartial protein variants; host-specific expression systems sn-Glycerol-3-phosphate specificity
Brucella melitensisCell-free expression; partial sequences Periplasmic binding protein dependency

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ugpA; RB0403; SMb20417; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
ugpA
Target Protein Sequence
MQRVVFPNKILPYLLVAPQIVLTIVFFFWPASQALYQSVIREDPFGLKSGFVGFANFSAV LSEANYLNSLKVTVIFSVLTALLAMGVALLLATAADRVVRGKTFYRTLLIWPYAVAPAVA GMLWLFMFNPAMGTFAYMLRRNGFHWDPLLNGNHAMILIVVAAAWKQISYNFLFFVAGLQ AIPKSLIEAAAIDGARGTRRFWTIIFPLLAPTTFFLLVVNTVYAFFDTFGIIHSVTGGGP ARATETLVYKVYNDGFVNLNLGSSAAQSVILMAIVIGLTAFQFRFVEKRVHYG
Uniprot No.

Target Background

Function
This protein, ugpA, is part of the ABC transporter complex UgpABCE, involved in sn-glycerol-3-phosphate import. It is believed to be responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of the ugpA permease protein in Rhizobium meliloti's sn-glycerol-3-phosphate transport system?

The ugpA protein in R. meliloti functions as a permease component of an ABC-type transporter system specialized for glycerol-3-phosphate uptake. Unlike the facilitated diffusion mechanisms used by organisms such as Escherichia coli and Pseudomonas aeruginosa, Rhizobium species employ active transport processes for glycerol and glycerol-related compounds . The ugpA gene likely works in concert with other components of the transport system, similar to the organization seen in related species where glycerol utilization genes are clustered together in a functional operon . This active transport mechanism allows R. meliloti to efficiently acquire glycerol-3-phosphate, which serves both as a carbon source and as a signaling molecule in plant-microbe interactions .

How do experimental approaches for studying transport proteins in R. meliloti differ from those used with other bacterial species?

Studying transport proteins in R. meliloti requires specialized approaches tailored to this symbiotic bacterium:

  • Genetic manipulation techniques:

    • Transposon mutagenesis using Tn5-based systems to generate reporter fusions

    • Plasmid integration via single-crossover for targeted gene disruption

    • Site-directed mutagenesis of conserved domains to analyze structure-function relationships

  • Expression analysis methodologies:

    • RT-qPCR with specialized reference genes (16S ribosomal RNA and Polyribonucleotide nucleotidyltransferase)

    • Reporter fusion assays (phoA, lacZ) to monitor expression under different conditions

    • Induction studies using specific carbon sources (succinate, raffinose, glycerol)

  • Transport assays:

    • Radiolabeled substrate uptake measurements normalized to cell density

    • Diauxic growth analyses to detect carbon source preferences and repression effects

    • Competition assays to evaluate substrate specificity

These approaches differ from those used with model organisms like E. coli due to R. meliloti's unique genetic background, symbiotic capabilities, and specialized carbon transport systems.

What are the optimal conditions for expressing recombinant ugpA protein for structural and functional studies?

For successful expression and characterization of recombinant ugpA protein:

ParameterOptimal ConditionNotes
Expression HostE. coli BL21(DE3) or R. meliloti with deletions of native ugp genesHost selection affects protein folding and functionality
Vector SystempET series for E. coli; broad-host-range vectors like pBBR1MCS for R. melilotiNeeds compatible antibiotic resistance markers
InductionIPTG (0.1-0.5 mM) for E. coli; native promoter or controlled expression systems for R. melilotiTemperature reduction to 16-20°C during induction improves solubility
Growth MediaM9 minimal medium supplemented with specific carbon sourcesAvoid glucose/succinate when studying native regulation
ExtractionMembrane fractionation after cell disruptionRequires detergent solubilization
PurificationAffinity chromatography (His-tag) followed by size exclusionTag position critical for maintaining function
Functional VerificationComplementation of transport-deficient mutantsEssential validation step

When designing expression constructs, it's critical to consider that membrane proteins like ugpA often require their native membrane environment or reconstitution into proteoliposomes for proper folding and function.

How does the expression of ugpA differ between free-living and symbiotic states of R. meliloti?

The expression pattern of transport proteins in R. meliloti changes dramatically during the transition from free-living to symbiotic states:

  • Free-living state: In soil environments, ugpA expression is likely regulated by carbon source availability. Similar to other transport systems in R. meliloti, it would be subject to catabolite repression by preferred carbon sources like succinate . Expression may be induced by the presence of glycerol-3-phosphate, as seen with related transport systems in Rhizobium species .

  • Symbiotic state: Based on patterns observed with other transport systems, ugpA likely undergoes significant regulatory changes during symbiosis. The agpA gene (involved in α-galactoside transport) is downregulated when R. meliloti transitions to an intracellular symbiont, suggesting that many nutrient transporters are reprogrammed during nodulation . This regulation involves symbiosis-specific regulators like SyrA, which is expressed at high levels in bacteroids but at low levels in free-living bacteria .

  • Regulatory mechanisms: The transition likely involves multiple regulatory elements, including:

    • Symbiosis-specific regulators (NodD3, SyrM, SyrA)

    • Global carbon metabolism regulators

    • Plant-derived signals present in the nodule environment

This differential expression reflects the dramatically different nutritional environment and metabolic demands of the bacteroid state.

What techniques are most effective for measuring ugpA-mediated transport activity in R. meliloti?

To accurately measure ugpA-mediated transport:

  • Radiolabeled substrate uptake assays:

    • Grow cultures to mid-log phase in defined medium

    • Harvest and wash cells to remove residual carbon sources

    • Resuspend to standardized density (OD600)

    • Add radiolabeled sn-glycerol-3-phosphate (typically 14C or 3H labeled)

    • Sample at time intervals, filter, wash, and measure radioactivity

    • Normalize counts to cell density

  • Growth-based functional assays:

    • Monitor growth kinetics in minimal medium with sn-glycerol-3-phosphate as sole carbon source

    • Compare wild-type, ugpA mutant, and complemented strains

    • Analyze diauxic growth patterns with mixed carbon sources

  • Competitive transport inhibition:

    • Measure uptake in presence of potential competing substrates

    • Calculate inhibition constants to determine substrate specificity

  • In vivo reporter systems:

    • Create transcriptional/translational fusions to reporter genes

    • Monitor expression under different conditions

    • Use fluorescent protein tags for localization studies

These methods should be combined to comprehensively characterize transport activity, as each provides unique information about different aspects of the transport process.

How do post-translational modifications affect the function and stability of recombinant ugpA protein?

Post-translational modifications significantly impact ugpA function and stability:

  • Phosphorylation:

    • Potential phosphorylation sites in cytoplasmic loops can modulate transport activity

    • Phosphoproteomic analysis can identify regulatory phosphorylation events

    • Site-directed mutagenesis of serine/threonine/tyrosine residues to phosphomimetic (Asp/Glu) or non-phosphorylatable (Ala) variants helps determine functional significance

  • Membrane insertion and folding:

    • Proper membrane insertion requires the bacterial Sec translocon

    • Incorrect folding can lead to protein degradation or aggregation

    • Topology analysis using PhoA/LacZ fusions can verify proper membrane orientation

  • Protein-protein interactions:

    • Association with other ABC transporter components (ATP-binding proteins, substrate-binding proteins)

    • Interactions with regulatory proteins that may modulate activity

    • Crosslinking studies and pull-down assays can identify interacting partners

  • Stability optimization strategies:

    • Addition of stabilizing mutations identified through directed evolution

    • Use of specialized detergents for membrane protein extraction and purification

    • Nanodiscs or proteoliposomes for functional reconstitution

These modifications must be carefully considered when expressing and studying recombinant ugpA, as they can significantly impact experimental outcomes and interpretation.

What are the molecular mechanisms of catabolite repression affecting ugpA expression in R. meliloti?

Catabolite repression of transport systems in R. meliloti involves complex regulatory mechanisms:

  • Carbon source hierarchy:

    • R. meliloti strongly prefers succinate and other dicarboxylic acids as carbon sources

    • This preference manifests through repression of transport systems for secondary carbon sources when preferred sources are present

    • Similar to the agpA system, ugpA expression is likely repressed in the presence of succinate

  • Molecular components:

    • Unlike the cAMP-CRP system in E. coli, R. meliloti employs different regulatory proteins

    • The syrA gene product is involved in downregulating certain transport systems

    • Global transcriptional regulators likely coordinate carbon source utilization

  • Experimental evidence from similar systems:

    • The agpA::TnphoA reporter is highly expressed when R. meliloti is grown on raffinose but repressed when grown on succinate plus raffinose

    • Screening for catabolite repression mutants has identified regulatory components

  • Practical implications:

    • Medium composition critically affects expression of transport systems

    • Experimental design must account for these regulatory effects

    • Carbon source selection influences interpretation of transport studies

Understanding these regulatory mechanisms is essential for designing expression systems and interpreting experimental results related to ugpA function.

How do mutations in conserved domains of ugpA affect substrate specificity and transport kinetics?

Structure-function analysis of ugpA reveals important relationships between protein domains and transport properties:

Domain TypeMutation EffectExperimental ApproachFunctional Impact
Transmembrane helicesAltered hydrophobic residuesAlanine scanning mutagenesisChanges in substrate translocation pathway
Cytoplasmic loopsModified charged residuesCharge reversal mutationsDisrupted interactions with ATP-binding component
Periplasmic loopsSubstituted polar residuesConservative/non-conservative replacementsAltered substrate recognition
Interface regionsDisrupted dimer formationCysteine crosslinkingImpaired transport complex assembly

Key findings from such analyses typically reveal:

  • Substrate specificity determinants:

    • Specific residues in transmembrane domains create substrate binding pockets

    • Mutations can broaden or narrow substrate range

    • Some mutations may allow transport of structurally related molecules beyond glycerol-3-phosphate

  • Transport kinetics alterations:

    • Mutations in conserved motifs often reduce transport efficiency (Vmax)

    • Some mutations affect substrate affinity (Km) without changing maximum transport rate

    • Certain mutations can uncouple substrate binding from translocation

  • Energy coupling effects:

    • Mutations at the interface with ATP-binding proteins can disrupt energy transduction

    • Some variants show transport activity but altered ATP hydrolysis coupling

These structure-function relationships provide insights into membrane transport mechanisms and can inform protein engineering efforts for biotechnological applications.

What role does the glycerol-3-phosphate transport system play in mediating systemic acquired resistance in legume hosts?

Glycerol-3-phosphate (G3P) transport systems play crucial roles in plant immune responses:

  • G3P as a mobile immune signal:

    • G3P functions as a mobile regulator of systemic acquired resistance (SAR)

    • It provides broad-spectrum systemic immunity in response to localized infections

    • G3P-derived foliar immunity is activated during incompatible interactions with rhizobia

  • Root-shoot-root signaling pathway:

    • Recognition of rhizobium incompatibility is root-driven

    • Bacterial exclusion requires G3P biosynthesis in the shoot

    • Biochemical evidence supports shoot-to-root transport of G3P during incompatible rhizobia interactions

  • Dual protection mechanism:

    • G3P enables plants to simultaneously exclude non-desirable rhizobia in roots and pathogens in shoots

    • This represents a coordinated whole-plant immunity strategy

    • Transport systems for G3P likely play regulatory roles in this process

  • Potential applications:

    • Engineering enhanced transport systems could improve plant resistance

    • Understanding G3P transport mechanisms may lead to novel crop protection strategies

    • Monitoring G3P levels could serve as a biomarker for effective symbiotic interactions

This research highlights the importance of G3P transport not just for carbon metabolism but also for signaling and immune functions in plant-microbe interactions.

How does the competitive ability of R. meliloti strains correlate with ugpA gene sequence variations in different soil environments?

Field and laboratory studies reveal important correlations between transport system genetics and competitive fitness:

  • Genetic diversity analysis:

    • ugpA sequences from diverse soil isolates show environment-specific polymorphisms

    • Some variants correlate with enhanced nodulation competitiveness

    • SNP analysis can identify functionally significant variation

  • Competitive nodulation dynamics:

    • Strains with optimized glycerol/G3P transport often show competitive advantages

    • Similar to glycerol utilization in R. leguminosarum, where mutants unable to use glycerol were deficient in competitiveness for nodulation

    • Co-inoculation experiments with variant strains reveal fitness differences

  • Soil-specific adaptations:

    • Different soil types (sandy, clay, acidic, alkaline) select for specific transporter variants

    • Adaptation to particular plant hosts may drive transporter evolution

    • Temperature and moisture regimes influence optimal transporter properties

  • Experimental methodology:

    • Field competition assays using differentially marked strains

    • qPCR-based quantification of strain ratios in nodules

    • Controlled environment studies isolating specific variables

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.