Recombinant Rhizobium meliloti Succinoglycan biosynthesis protein exoA (exoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
exoA; RB1082; SMb20957; Succinoglycan biosynthesis protein ExoA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
exoA
Target Protein Sequence
MSSDELTSTSSLIVIPCLNEASHIEALIEKLRPSLTPLNARVVIADGGSTDGTREIARRL ATEDPRVLFLDNPKRIQSAAVNRAVAELGAGSDYLIRIDAHGTYPDDYCERLVEDALATG ADSVVVAMQTVGFSTFQKATAFAQNSKLGNGGSKHRTGAVGHWAEHGHHALMRIEAFKAV GGYDESFSHNEDAELDYRLGKAGYRIWMTDKTSMVYYPRAKLVPLFWQYFGYGRGRAKNF LKHRAMPGLRQMLPLAVAPIAFGALLAIVNWMAVVPVGVWAAACLGYGVWMALGQRNPYG PLAAVAAMVMHLAWSAGFWRELLDFRRRVA
Uniprot No.

Target Background

Function
Glycosyltransferase essential for succinoglycan (EPS I) biosynthesis. Specifically, it facilitates the addition of the second sugar (glucose), catalyzing the formation of a β-1,3 linkage with the galactose lipid carrier.
Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical role of ExoA in succinoglycan biosynthesis?

ExoA functions as a glycosyltransferase that catalyzes one of the first steps in the assembly of the octasaccharide repeating unit of succinoglycan. Specifically, ExoA controls one of the initial glycosyltransferase reactions in the biosynthesis pathway . Succinoglycan is a high-molecular-weight polymer consisting of repeating octasaccharide units composed of one galactose and seven glucose residues, with acetyl, succinyl, and pyruvyl modifications .

The biosynthesis of succinoglycan occurs on a polyprenol-linked lipid carrier at the cytoplasmic face of the inner membrane. ExoA is part of a coordinated system of enzymes that sequentially add sugar residues to build the complete octasaccharide subunit. Research indicates that ExoA is a membrane-bound protein with three hydrophobic transmembrane domains, consistent with its role in membrane-associated polysaccharide synthesis .

Genetic studies have definitively shown that mutations in exoA result in defective succinoglycan production, which subsequently impairs the ability of Rhizobium meliloti to invade alfalfa nodules and establish effective nitrogen-fixing symbiosis .

How can I clone and express recombinant ExoA protein for in vitro studies?

Successful cloning and expression of ExoA requires specific molecular biology approaches optimized for membrane proteins. Based on established protocols for related proteins like ExoM, the following methodology is recommended:

  • Gene Amplification: PCR-amplify the exoA open reading frame (999 bp) from Rhizobium meliloti genomic DNA or a cosmid containing the exo gene cluster .

  • Vector Selection: Clone the exoA gene into an expression vector containing an inducible promoter system (such as the T7 promoter) and an appropriate fusion tag to facilitate detection and purification. The pET vector system has proven effective for related proteins .

  • Expression Conditions:

    • Transform the construct into an E. coli expression strain like BL21(DE3)/pLysS

    • Culture cells at 37°C to mid-log phase (OD600 ~0.6)

    • Induce protein expression with IPTG (typically 0.5-1.0 mM)

    • Continue growth for 2-3 hours at lower temperature (30°C) to enhance proper folding

  • Protein Extraction:

    • For membrane proteins like ExoA, standard cell lysis followed by membrane fraction isolation is required

    • Use ultracentrifugation (100,000 × g) to separate membrane fractions

    • Solubilize membrane fractions with appropriate detergents (CHAPS, DDM, or Triton X-100)

  • Verification: Confirm expression by SDS-PAGE and Western blotting using antibodies against the fusion tag or ExoA-specific antibodies .

Note that ExoA, like other membrane-bound glycosyltransferases in this pathway, may exhibit reduced activity when expressed recombinantly due to the importance of the membrane environment for proper folding and function.

What experimental methods are used to assess ExoA function in vivo?

Multiple complementary approaches are employed to evaluate ExoA function in living bacterial systems:

Genetic Approaches:

  • Targeted Gene Disruption: Creating exoA knockout mutants using transposon mutagenesis (Tn5) or targeted deletion

  • Complementation Analysis: Introducing functional exoA genes on plasmids to rescue mutant phenotypes

  • Site-Directed Mutagenesis: Creating specific amino acid substitutions to identify catalytic residues

Phenotypic Assays:

  • Calcofluor Binding: ExoA mutants fail to fluoresce under UV when grown on Calcofluor-containing medium, a rapid screening method for succinoglycan production

  • Nodulation Tests: Assessing the ability of exoA mutants to form effective nitrogen-fixing nodules on host plants (Medicago sativa/alfalfa)

  • Bacteriophage Sensitivity: Testing sensitivity to specific R. meliloti bacteriophages, as exo mutants show altered phage resistance patterns

Biochemical Analyses:

  • Exopolysaccharide Isolation: Precipitating secreted polysaccharides from culture supernatants with ethanol or cetrimide

  • Composition Analysis: Using HPLC, GC-MS, or NMR to determine the sugar composition and linkages in the polysaccharides produced by wild-type and exoA mutant strains

  • Lipid-Linked Intermediate Analysis: Analyzing accumulated biosynthetic intermediates in exoA mutants to determine the specific step blocked in the pathway

These combined approaches provide a comprehensive assessment of ExoA function in the context of the living bacterial cell and symbiotic interactions.

How do exoA mutations affect symbiotic interactions with host plants?

Mutations in exoA have profound effects on the symbiotic relationship between Rhizobium meliloti and legume hosts, particularly alfalfa (Medicago sativa). The specific impacts include:

Nodulation Defects:

  • exoA mutants typically form ineffective (non-nitrogen-fixing) nodules on alfalfa

  • The nodules appear to contain no bacteroids and form without shepherds' crooks or infection threads

  • The exopolysaccharide produced by ExoA activity is not required for nodule formation itself but is crucial for wild-type nodule invasion

Molecular Basis of Symbiotic Deficiency:

  • The absence of functional ExoA prevents the synthesis of the complete succinoglycan octasaccharide subunit

  • Low-molecular-weight (LMW) succinoglycan, particularly trimers of the octasaccharide subunit, has been identified as the symbiotically active form

  • Without ExoA, the bacteria cannot produce this signal molecule necessary for successful invasion of the host plant's root nodules

Complementation Analysis:

  • Introduction of plasmids containing functional exoA genes can restore effective nodulation in exoA mutants

  • This complementation confirms that the symbiotic defect is specifically due to the loss of ExoA function and not polar effects on other genes

This relationship between ExoA, succinoglycan biosynthesis, and symbiotic effectiveness underscores the critical role of specific bacterial polysaccharides in plant-microbe communication during symbiosis establishment.

What is the relationship between ExoA and other enzymes in the succinoglycan biosynthesis pathway?

ExoA functions within a coordinated network of enzymes encoded by the exo gene cluster. Understanding these relationships is crucial for comprehensive pathway characterization:

Sequential Enzymatic Activities:

  • ExoY initiates the pathway by transferring the first sugar (galactose) to the lipid carrier

  • ExoA catalyzes the second step in the pathway, likely transferring a glucose residue to the galactose

  • Subsequent steps involve additional glycosyltransferases (ExoL, ExoM, ExoO, ExoU, ExoW) that add the remaining glucose residues

  • Modification enzymes (ExoZ, ExoH, ExoV) add acetyl, succinyl, and pyruvyl groups, respectively

Protein-Protein Interactions:

  • The glycosyltransferases in this pathway likely form a multienzyme complex at the cytoplasmic membrane

  • ExoA may physically interact with both ExoY (the preceding enzyme) and ExoL (the subsequent enzyme) to facilitate efficient substrate channeling

  • Evidence from related systems suggests that disrupting one component of this complex can affect the stability or activity of other components

Regulatory Relationships:

  • ExoR and ExoS function as negative regulators of the exo genes

  • Mutations in exoR or exoS result in overproduction of succinoglycan

  • Interestingly, certain classes of exo mutations (including exoA) are lethal in an exoR95 or exoS96 background unless complemented by a plasmid, suggesting complex regulatory interactions

EnzymeGeneFunctionSubstrateProduct
ExoYexoYGalactosyltransferaseLipid carrierGal-P-P-lipid
ExoAexoAGlucosyltransferaseGal-P-P-lipidGlc-Gal-P-P-lipid
ExoLexoLGlucosyltransferaseGlc-Gal-P-P-lipidGlc-Glc-Gal-P-P-lipid
ExoMexoMβ1-4 GlucosyltransferaseGlc-Glc-Gal-P-P-lipidGlc-Glc-Glc-Gal-P-P-lipid
ExoOexoOGlucosyltransferaseTetrasaccharide-P-P-lipidPentasaccharide-P-P-lipid
ExoUexoUGlucosyltransferasePentasaccharide-P-P-lipidHexasaccharide-P-P-lipid
ExoWexoWGlucosyltransferaseHexasaccharide-P-P-lipidOctasaccharide-P-P-lipid

This integrated understanding of pathway relationships is essential for designing experiments to study ExoA in its proper biochemical context.

What structural features characterize the ExoA protein?

ExoA exhibits several key structural features characteristic of membrane-associated glycosyltransferases:

Primary Structure:

  • The exoA gene contains a 999-base-pair open reading frame encoding a 332-amino-acid protein with a molecular weight of approximately 36.8 kDa

  • The theoretical isoelectric point (pI) of ExoA is approximately 9.49, indicating a basic protein

Membrane Topology:

  • ExoA is a membrane protein with three predicted hydrophobic transmembrane domains

  • This membrane association is consistent with its role in synthesizing lipid-linked oligosaccharides at the cytoplasmic membrane

Secondary Structure:

  • Secondary structure analysis indicates that ExoA is composed of approximately 45.48% α-helix, 13.55% β-sheet, and 40.96% random coil structures

  • These structural elements are distributed throughout the protein, with the transmembrane domains primarily composed of α-helical regions

Conserved Domains:

  • ExoA contains conserved domains characteristic of family 2 glycosyltransferases

  • A catalytic domain likely resides in the cytoplasmic portion of the protein

  • Conserved residues involved in nucleotide-sugar binding and catalysis can be identified through sequence alignment with related glycosyltransferases

Homology:

  • ExoA shows sequence similarity to other bacterial glycosyltransferases involved in polysaccharide synthesis

  • Structural modeling based on homologous proteins with known crystal structures can provide insights into the three-dimensional organization of ExoA

While the complete three-dimensional structure of ExoA has not been experimentally determined, these features provide valuable insights into its functional architecture and have implications for experimental design when studying this protein.

How can advanced genetic engineering approaches be used to modify ExoA for enhanced function?

Genetic engineering of ExoA presents opportunities for both fundamental research and potential applications. Several sophisticated approaches can be employed:

Structure-Guided Mutagenesis:

  • Identify catalytic residues through comparative sequence analysis and create point mutations to study reaction mechanisms

  • Design mutations in substrate binding regions to potentially alter sugar specificity

  • Modify transmembrane domains to investigate membrane association requirements

Domain Swapping:

  • Create chimeric proteins by exchanging domains between ExoA and related glycosyltransferases to explore functional determinants

  • For example, swapping domains between ExoA and homologous enzymes from other Rhizobium species could provide insights into host specificity differences

Protein Fusion Strategies:

  • Generate fusion proteins with fluorescent tags (GFP, mCherry) for localization studies while minimizing functional disruption

  • Create bifunctional enzymes by fusing ExoA with complementary glycosyltransferases to improve pathway efficiency

Expression Optimization:

  • Design synthetic exoA genes with codon optimization for heterologous expression systems

  • Implement inducible and tunable promoter systems to control ExoA expression levels precisely

CRISPR-Cas9 Applications:

  • Use CRISPR-Cas9 genome editing to create precise chromosomal modifications of exoA

  • Implement CRISPR interference (CRISPRi) for tunable repression of exoA expression

Directed Evolution:

  • Develop high-throughput screening methods to select for ExoA variants with enhanced activity or altered properties

  • Implement error-prone PCR or DNA shuffling techniques to generate diversity in the ExoA sequence

The effectiveness of these approaches can be assessed using a combination of in vivo phenotypic assays (succinoglycan production, nodulation efficiency) and in vitro biochemical characterization of the engineered ExoA variants.

What experimental design considerations are important when studying ExoA-substrate interactions?

Investigating the interactions between ExoA and its substrates requires careful experimental design to overcome several methodological challenges:

Substrate Preparation:

  • Obtain or synthesize authentic lipid-linked substrates (Gal-P-P-lipid)

  • Consider using both natural substrates extracted from appropriate exo mutant strains and synthetic analogues with simplified lipid moieties

  • Implement radioisotope or fluorescent labeling strategies to facilitate detection of reaction products

In Vitro Reaction Conditions:

  • Optimize buffer composition (pH, ionic strength) based on related glycosyltransferases like ExoM

  • Include appropriate metal cofactors (typically Mg²⁺ or Mn²⁺) that may be required for catalytic activity

  • Incorporate detergents at concentrations above their critical micelle concentration to maintain membrane protein stability while avoiding inhibition

Analytical Methods:

  • Develop TLC systems capable of resolving lipid-linked oligosaccharide intermediates

  • Implement mass spectrometry approaches (MALDI-TOF MS or ESI-MS) for precise structural characterization of reaction products

  • Consider NMR analysis to confirm glycosidic linkage formation and configuration

Kinetic Analysis Considerations:

  • Design assays that can operate under initial velocity conditions

  • Account for potential substrate inhibition or product inhibition effects

  • Consider using continuous assays that monitor either UDP-glucose consumption or product formation in real-time

Control Experiments:

  • Include heat-inactivated enzyme controls

  • Test substrate specificity using various UDP-sugars

  • Evaluate the requirement for the lipid moiety by testing water-soluble oligosaccharide acceptors

This experimental framework allows for robust characterization of ExoA's substrate specificity, catalytic mechanism, and structure-function relationships, providing deeper insights into its role in succinoglycan biosynthesis.

How does ExoA activity compare with homologous enzymes from other bacterial species?

Comparative analysis of ExoA with homologous enzymes provides valuable insights into evolutionary conservation and functional specialization:

Homology Patterns:

  • ExoA shares significant sequence similarity with glycosyltransferases from other Rhizobiaciae, including Sinorhizobium species, Agrobacterium species, and Mesorhizobium species

  • More distant homologs exist in other Gram-negative bacteria that produce exopolysaccharides, including Xanthomonas and Pseudomonas species

Functional Conservation:

  • The catalytic mechanism appears to be conserved across homologous enzymes

  • Substrate specificity varies between species, reflecting the diversity of exopolysaccharide structures produced by different bacteria

  • Membrane topology is generally conserved, with most homologs containing 2-4 transmembrane domains

Species-Specific Features:

  • The Agrobacterium sp. M-503 ExoA homolog (36.8 kDa) shares structural features with R. meliloti ExoA but may have evolved specific adaptations for its ecological niche

  • Different rhizobial species produce structurally distinct exopolysaccharides that correlate with their host plant specificity

Experimental Approaches for Comparative Studies:

  • Conduct complementation experiments by expressing ExoA homologs in R. meliloti exoA mutants

  • Perform in vitro activity assays using standardized substrates to compare kinetic parameters

  • Generate phylogenetic analyses of ExoA sequences to correlate with bacterial taxonomy and host plant specificity

This comparative approach provides evolutionary context for ExoA function and may reveal insights into the adaptation of succinoglycan biosynthesis to different symbiotic relationships.

What systems biology approaches can integrate ExoA research into broader pathway models?

Systems biology offers powerful tools to contextualize ExoA within the complete succinoglycan biosynthesis pathway and broader cellular processes:

Multi-Omics Integration:

  • Combine transcriptomics data on exoA expression with proteomics data on ExoA protein levels under various conditions

  • Integrate metabolomics analyses of succinoglycan intermediates to identify pathway bottlenecks

  • Correlate genomic variations in exoA across strains with phenotypic differences in succinoglycan production

Protein Interaction Networks:

  • Use techniques like bacterial two-hybrid systems or co-immunoprecipitation to map the protein interaction network of ExoA

  • Apply proximity labeling methods (BioID, APEX) to identify proteins physically close to ExoA in vivo

  • Integrate interaction data into models of the multienzyme complex responsible for succinoglycan biosynthesis

Ontology Development:

  • Utilize the Exposure Science Ontology (ExO) framework to standardize terminology and facilitate data integration

  • Incorporate ExoA research into broader ontologies covering bacterial polysaccharide biosynthesis

Computational Tools:

  • Implement machine learning approaches to predict the effects of exoA mutations on protein function and pathway output

  • Develop visualization tools to represent the complex relationships between pathway components

  • Create databases integrating ExoA data across multiple experimental systems

By applying these systems biology approaches, researchers can develop a more comprehensive understanding of how ExoA functions within the broader context of bacterial physiology and plant-microbe interactions.

How can contradictory experimental results regarding ExoA function be reconciled?

Researchers sometimes encounter seemingly contradictory results when studying ExoA. Resolving these discrepancies requires systematic approaches:

Common Sources of Discrepancies:

  • Strain Differences:

    • R. meliloti/S. meliloti strain variations can affect experimental outcomes

    • Different laboratory strains may contain uncharacterized secondary mutations

  • Methodological Variations:

    • Different protocols for assessing succinoglycan production can yield conflicting results

    • Variations in growth conditions can alter exo gene expression

  • Mutation Effects:

    • Insertion mutations in exoA may have polar effects on downstream genes, complicating interpretation

    • Deletion mutations may be more specific but can sometimes affect regulatory elements

Resolution Strategies:

  • Comprehensive Genetic Analysis:

    • Create both insertion and deletion mutations in exoA in the same genetic background

    • Perform complementation studies with wild-type exoA expressed from various promoters

    • Analyze the effects of mutations on the expression of neighboring genes

  • Standardized Phenotypic Assays:

    • Implement multiple independent methods to assess succinoglycan production

    • Quantify both high and low molecular weight succinoglycan fractions

    • Use consistent growth conditions across experiments

  • Molecular Characterization:

    • Directly analyze the accumulation of lipid-linked intermediates in different mutant backgrounds

    • Use mass spectrometry to definitively identify the structures of accumulated intermediates

    • Perform in vitro reconstitution experiments with purified components

By systematically addressing these factors, researchers can reconcile contradictory results and develop a more accurate model of ExoA function. This approach is exemplified by studies of related proteins like ExoK, where researchers identified that deletion mutants and insertion mutants produced different symbiotic phenotypes due to polar effects on downstream exoLAMON genes .

What advanced analytical techniques are most effective for studying ExoA-dependent succinoglycan modifications?

Characterizing the products of ExoA activity requires sophisticated analytical approaches that can distinguish subtle structural differences in complex polysaccharides:

Chromatographic Methods:

  • High-Performance Anion-Exchange Chromatography (HPAEC): Provides excellent separation of oligosaccharides with different degrees of polymerization

  • Size Exclusion Chromatography (SEC): Differentiates between high molecular weight succinoglycan and low molecular weight forms (monomers, dimers, trimers)

  • Hydrophobic Interaction Chromatography (HIC): Separates oligosaccharides based on their hydrophobic modifications (acetyl, succinyl, pyruvyl groups)

Mass Spectrometry Techniques:

  • MALDI-TOF MS: Effective for determining the molecular weight of intact oligosaccharide subunits

  • Electrospray Ionization MS (ESI-MS): Provides detailed structural information and can be coupled with liquid chromatography (LC-MS)

  • Tandem MS (MS/MS): Enables detailed structural characterization through fragmentation patterns

  • Ion Mobility MS: Separates isomeric structures based on their three-dimensional conformation

Nuclear Magnetic Resonance (NMR) Approaches:

  • 1D and 2D NMR: Determines the exact linkage positions and anomeric configurations

  • HSQC NMR: Maps carbon-hydrogen correlations to determine sugar identities and linkages

  • NOESY/ROESY: Provides information about spatial relationships between different parts of the oligosaccharide

Enzymatic Analysis Methods:

  • Specific Glycosidase Treatments: Using enzymes that cleave specific linkages to determine structural features

  • Linkage Analysis: Determining linkage positions through methylation analysis followed by GC-MS

  • Enzymatic Sequencing: Sequential digestion with specific enzymes to determine the order of sugars

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.