Recombinant Rhizobium meliloti Succinoglycan biosynthesis transport protein exoP (exoP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium meliloti Succinoglycan Biosynthesis Transport Protein exoP

The Recombinant Rhizobium meliloti Succinoglycan biosynthesis transport protein exoP (exoP) is a crucial enzyme involved in the biosynthesis and transport of succinoglycan, an acidic exopolysaccharide produced by Rhizobium meliloti. Succinoglycan plays a vital role in the symbiotic relationship between R. meliloti and its host plant, Medicago sativa (alfalfa), facilitating the invasion of root nodules . The exoP protein is part of the exo gene cluster responsible for succinoglycan production .

Structure and Function of exoP

The exoP protein is a full-length protein consisting of 786 amino acids and is associated with the plasma membrane . It is involved in the polymerization of octasaccharide subunits or the transport of the completed succinoglycan polymer . Specific amino acid substitutions within the proline-rich motif of exoP can alter the production of succinoglycan, favoring the synthesis of low-molecular-weight (LMW) forms over high-molecular-weight (HMW) forms .

Recombinant Expression of exoP

Recombinant full-length Rhizobium meliloti succinoglycan biosynthesis transport protein exoP is expressed in Escherichia coli and is available as a His-tagged protein . This recombinant form facilitates research into the biochemical properties and functions of exoP.

Research Findings

Research on exoP mutants has shown that specific amino acid substitutions within the proline-rich motif can enhance the production of LMW succinoglycan at the expense of HMW succinoglycan . Additionally, the absence of the C-terminal cytoplasmic domain of exoP also leads to increased LMW succinoglycan production .

References Specific Amino Acid Substitutions in the Proline-Rich Motif of the ExoP Protein of Rhizobium meliloti Alter the Production of Succinoglycan. The 32-kilobase exp gene cluster of Rhizobium meliloti directing the biosynthesis of galactoglucan (exopolysaccharide II). Biosynthesis of succinoglycan, a symbiotically important exopolysaccharide of Rhizobium meliloti. Specific Amino Acid Substitutions in the Proline-Rich Motif of the ExoP Protein of Rhizobium meliloti Alter the Production of Succinoglycan. UniProtKB - P33698 (EXOP_RHIME). Succinoglycan Production by Rhizobium meliloti Is Regulated by the ExoS-ChvI Two-Component Regulatory System. Recombinant Full Length Rhizobium meliloti Succinoglycan Biosynthesis Transport Protein exoP (exoP) Protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
exoP; RB1086; SMb20961; Succinoglycan biosynthesis transport protein ExoP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-786
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
exoP
Target Protein Sequence
MNRTAPMKQRSVPLSSIMPSEEQSDGFIDLDRLVAAVFRRARLVAAFVVLFIALGAAYLL FATPYYTSMTQILLDENLSKYAEEEPTPVNSQMLDTQIASAVEILKSGELALRVVDKLKL SENDTILNPPRSPVDMVKEWLKTATGLFSGGPDVTEEAARNGRRQKAAAIIQQSLAVERV SRSSVVAVAFRSSDPLLAATIARGYASAYLTDQLNANFEATERASVWLQERLTDLQQRSQ AAALEVAHFRAENGLTAARGELMSEQQMADLNSQLIVAQADTASASARYDQYKSIVDQGP ENAVKNATISSKEGDNSVIRDLRTRYLTVGKREREVSDNFGADHPQAVSLRAEQEDVARQ IYQELQQLTASYKNEYEVAQSREESLRKSIQGIAGKTSDASEQLVQLRELEQKAAALKTL YESYLGRYEQATQQQSFPIAKARVISEAGVPVSPSSPKKTMTLALSAVLGMMVGGAYAAF LEFRERTFRLEGNIRSILGHRSLGYVPLLGTRMKKKAQLVHAHFGSVKRHDEAVDDTMPF QRLSRIVVDAPRSTFAETFRNAKLACDQMLAGSESRVIAIASALPDEGKSIIAANFAALL AASGKRTLLIDADIRKPGLTQMITPAPRTGLVETLIGEASWPAGIKVDQRTKLAILPAGG ASHQRHQSNELLASPAMANLIENARNAFDYVVVDLAALAPVVDAKAFAPLADGILFVVEW GRTPSRLVRDLLHSEPLINSKVLGVILNKTDMNELGKYSDFDGAEKYRHRYGKYYVENTI TENTAA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ExoP and what is its role in succinoglycan biosynthesis?

ExoP is a membrane-associated protein involved in the biosynthesis of succinoglycan (also called exopolysaccharide I or EPS I) in Rhizobium meliloti. It plays a critical role in determining the molecular weight distribution of succinoglycan by influencing polymerization and export of EPS I . ExoP works alongside other membrane-associated proteins like ExoQ and ExoT to facilitate the production of both high-molecular-weight (HMW) and low-molecular-weight (LMW) forms of EPS I. The protein's function is crucial for the invasion of Medicago sativa (alfalfa) root nodules by R. meliloti, as succinoglycan mediates this symbiotic interaction .

What is the structure and organization of the ExoP protein?

The ExoP protein consists of several distinct domains with specific functions:

  • A proline-rich motif (RX₄PX₂PX₄SPKX₉IXGXMXGXG) located from positions 443 to 476

  • A C-terminal cytoplasmic domain (positions 484 to 786)

  • A Walker A ATP-binding motif within the cytoplasmic domain

  • Tyrosine residues that can be phosphorylated

The protein's structural organization enables it to span the bacterial membrane, with the cytoplasmic domain exhibiting enzymatic activities including ATPase and autophosphorylating protein tyrosine kinase activity . This architecture allows ExoP to integrate environmental signals and translate them into appropriate regulation of succinoglycan biosynthesis.

How does succinoglycan contribute to symbiosis between R. meliloti and alfalfa?

Succinoglycan plays a crucial role in the invasion of Medicago sativa root nodules by R. meliloti . Specifically, the low-molecular-weight (LMW) forms of succinoglycan, particularly trimers of the octasaccharide subunit, have been identified as the symbiotically active species . These LMW forms facilitate infection thread formation and progression during the root nodule invasion process.

Interestingly, different mutations in exoP can result in divergent symbiotic phenotypes. Some exoP mutants can establish effective symbiosis with alfalfa despite producing no detectable EPS I polymer, while other mutations completely prevent effective symbiosis . This suggests a complex relationship between ExoP function, succinoglycan production, and symbiotic effectiveness that may involve additional factors beyond simply the presence or absence of EPS I.

What is the molecular composition of succinoglycan produced by R. meliloti?

Succinoglycan (EPS I) produced by R. meliloti has the following structural characteristics:

  • It is a polymer of octasaccharide repeating units

  • Each repeating unit contains seven glucose molecules and one galactose molecule

  • The sugar molecules are joined by β-1,4, β-1,3, and β-1,6 glycosidic linkages

  • The repeating units can be decorated by acetyl, succinyl, and pyruvyl groups

R. meliloti produces two forms of succinoglycan:

  • High-molecular-weight (HMW) form: Extended polymers of the octasaccharide units

  • Low-molecular-weight (LMW) form: Consisting of monomers, dimers, and trimers of the octasaccharide subunit

The ratio between these two forms is influenced by ExoP function and environmental factors like osmolarity .

What is the genetic organization of exoP and related genes?

The exoP gene is located within a 27-30 kb gene cluster on megaplasmid 2 of R. meliloti . This cluster contains numerous exo and exs genes involved in succinoglycan biosynthesis. Transcriptional analysis has revealed that exoP is part of a larger transcriptional unit, the exoHKLAMONP gene cluster .

The expression of exoP is regulated by multiple promoters with varying strengths:

  • A strong promoter upstream of exoH that can direct transcription of the entire exoHKLAMONP gene cluster

  • A weaker promoter upstream of exoL involved in the transcription of the exoLAMONP genes

  • A weak promoter identified directly upstream of exoP itself

This complex transcriptional organization allows for precise regulation of exoP expression under different conditions.

How do specific amino acid substitutions in the proline-rich motif of ExoP affect succinoglycan production?

Specific amino acid substitutions within the proline-rich motif (RX₄PX₂PX₄SPKX₉IXGXMXGXG) of ExoP significantly alter succinoglycan production patterns. Research has demonstrated that substituting both arginine₄₄₃ with isoleucine₄₄₃ and proline₄₅₇ with serine₄₅₇ results in enhanced production of low-molecular-weight (LMW) EPS I at the expense of high-molecular-weight (HMW) EPS I .

This finding suggests that the proline-rich motif functions as a regulatory domain that influences the distribution between HMW and LMW forms of succinoglycan. The altered amino acid sequence likely changes the structural conformation of this region, modifying interactions with other components of the succinoglycan biosynthesis machinery. Researchers investigating structure-function relationships should consider:

  • Creating single and double amino acid substitutions in this motif

  • Analyzing how each substitution affects the ratio of HMW to LMW succinoglycan

  • Correlating structural changes with functional outcomes using molecular modeling approaches

These substitutions provide a powerful experimental system for investigating the molecular mechanisms governing succinoglycan polymerization and export.

What is the role of the C-terminal cytoplasmic domain of ExoP?

The C-terminal cytoplasmic domain of ExoP (positions 484 to 786) plays crucial roles in regulating succinoglycan biosynthesis through multiple mechanisms:

  • It possesses ATPase activity essential for ExoP function

  • It contains tyrosine residues that undergo phosphorylation

  • It likely mediates protein-protein interactions with other components of the succinoglycan biosynthesis machinery

Mutants lacking this C-terminal cytoplasmic domain show enhanced production of LMW EPS I at the expense of HMW EPS I , indicating that this domain is critical for determining the molecular weight distribution of succinoglycan. This suggests that the domain functions as a regulatory module that favors the production of HMW succinoglycan when intact.

The dual enzymatic activities (ATPase and tyrosine kinase) of this domain suggest that it integrates multiple cellular signals, possibly including energy status and phosphorylation-based signaling, to modulate succinoglycan biosynthesis in response to environmental conditions.

How does the ATPase activity of ExoP influence succinoglycan biosynthesis?

The cytoplasmic domain of ExoP exhibits ATPase activity that is essential for proper succinoglycan biosynthesis . Mutations in the highly conserved Walker A ATP-binding motif eliminate this ATPase activity and result in profoundly altered succinoglycan production:

These findings suggest that ATP hydrolysis by ExoP provides energy for processes such as:

  • Polymerization of octasaccharide subunits

  • Export of succinoglycan polymers across the bacterial membrane

  • Conformational changes in ExoP that mediate interactions with other biosynthetic proteins

Researchers studying ExoP function should consider designing experiments that:

  • Measure ATP binding and hydrolysis rates of wild-type and mutant ExoP proteins

  • Correlate ATPase activity with succinoglycan polymerization efficiency

  • Investigate how ATP availability affects ExoP function in vivo

What is the relationship between ExoP tyrosine phosphorylation and succinoglycan molecular weight?

ExoP shares similarities with proteins possessing autophosphorylating protein tyrosine kinase activity and has been shown to be phosphorylated on tyrosine residues . Site-directed mutagenesis of specific tyrosine residues in the cytoplasmic domain results in altered ratios of LMW to HMW succinoglycan .

This phosphorylation-dependent regulation creates a sophisticated control mechanism where:

  • Tyrosine phosphorylation states of ExoP influence its activity in promoting either HMW or LMW succinoglycan production

  • Changes in environmental conditions may trigger phosphorylation/dephosphorylation events that adjust the balance between different molecular weight forms

  • The tyrosine kinase activity may integrate multiple cellular signals to fine-tune succinoglycan biosynthesis

The precise relationship between phosphorylation of specific tyrosine residues and ExoP function remains an important area for future research, with significant implications for understanding the regulation of succinoglycan biosynthesis.

How do environmental factors influence ExoP function and succinoglycan production?

Environmental factors, particularly osmolarity, significantly influence ExoP function and the molecular weight distribution of succinoglycan. Research has demonstrated that the ratios of HMW to LMW EPS I in both wild-type and mutant strains increase with osmolarity .

This osmolarity-dependent regulation has several implications:

  • It suggests that ExoP functions as a sensor that adjusts succinoglycan production in response to environmental conditions

  • It provides a mechanism for bacteria to modify their exopolysaccharide composition in different soil conditions

  • It may represent an adaptation for optimizing symbiotic interactions under varying environmental stresses

The molecular mechanism of this osmolarity sensing likely involves:

  • Changes in membrane tension affecting ExoP conformation

  • Altered interactions between ExoP and other membrane proteins

  • Modified enzymatic activities (ATPase or tyrosine kinase) under different osmotic conditions

Researchers investigating environmental regulation should design experiments that systematically vary osmolarity and other environmental parameters while monitoring ExoP activity and succinoglycan profiles.

How do different exoP mutations result in divergent symbiotic phenotypes?

Different mutations in exoP can result in remarkably divergent symbiotic phenotypes with alfalfa. Some exoP mutants establish effective symbiosis despite producing no detectable EPS I polymer, while other mutations completely prevent effective symbiosis .

This divergence suggests:

  • ExoP may have multiple functions beyond regulating succinoglycan biosynthesis

  • Certain ExoP domains may be involved in producing other symbiotically relevant factors

  • The relationship between succinoglycan production and symbiotic effectiveness is complex and non-linear

To understand these divergent phenotypes, researchers should:

  • Create a comprehensive library of exoP mutations targeting different domains

  • Characterize each mutant's succinoglycan production profile and symbiotic phenotype

  • Investigate potential secondary effects of exoP mutations on other cellular processes

A systematic structure-function analysis correlating specific mutations with both molecular and symbiotic phenotypes would provide valuable insights into the multifaceted roles of ExoP.

What are the best methods for creating site-directed mutations in exoP?

When creating site-directed mutations in exoP, researchers should consider the following methodological approaches:

  • PCR-based mutagenesis: Using overlapping primers containing the desired mutation to amplify the entire plasmid containing exoP, followed by DpnI digestion to remove the template DNA.

  • CRISPR-Cas9 genome editing: For directly introducing mutations into the chromosomal copy of exoP in R. meliloti.

  • Two-step allelic exchange: Using suicide vectors containing the mutated exoP sequence for homologous recombination into the R. meliloti genome.

Methodology table for exoP mutagenesis approaches:

MethodAdvantagesLimitationsBest Use Case
PCR-based mutagenesisRapid, efficient for single mutationsLimited to plasmid-based systemsCreating single amino acid substitutions
CRISPR-Cas9Chromosomal modifications, marker-freeRequires optimized protocols for R. melilotiPrecise genomic modifications
Allelic exchangeWell-established in rhizobiaTime-consuming, requires selection markersComplete gene replacements

When designing primers for mutagenesis, researchers should ensure the codon changes minimize disruption to mRNA secondary structure while maximizing expression efficiency in R. meliloti.

How can researchers quantify different molecular weight forms of succinoglycan?

Accurate quantification of different molecular weight forms of succinoglycan requires a multi-faceted approach:

  • Gel filtration chromatography: Separate HMW and LMW fractions based on size exclusion principles.

  • Anthrone-sulfuric acid colorimetric assay: Quantify total hexose content in separated fractions.

  • HPLC analysis: For detailed characterization of LMW fractions (monomers, dimers, trimers).

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): For precise molecular weight determination of different fractions.

Methodology workflow:

  • Culture bacteria under standardized conditions

  • Collect supernatant and precipitate EPS with 3 volumes of ethanol

  • Resuspend precipitate and fractionate by gel filtration

  • Analyze fractions using anthrone-sulfuric acid assay to quantify carbohydrate content

  • Further analyze LMW fractions by HPLC

  • Express results as ratio of HMW to LMW succinoglycan

This comprehensive approach enables precise quantification of the molecular weight distribution, which is essential for characterizing the effects of ExoP mutations on succinoglycan biosynthesis.

What techniques are effective for studying ExoP protein-protein interactions?

Understanding ExoP's interactions with other proteins is crucial for elucidating its function in succinoglycan biosynthesis. Effective techniques include:

  • Bacterial two-hybrid systems: Adapted for membrane proteins, allowing in vivo detection of interactions.

  • Co-immunoprecipitation: Using epitope-tagged ExoP to pull down interacting partners.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified ExoP domains and potential partners.

  • Chemical cross-linking coupled with mass spectrometry: To capture transient interactions within the membrane environment.

  • Blue native PAGE: For preserving and analyzing membrane protein complexes containing ExoP.

When designing protein interaction studies, researchers should consider:

  • The membrane-associated nature of ExoP requires specialized approaches

  • Interactions may be transient or dependent on physiological conditions

  • Both the proline-rich motif and the cytoplasmic domain may mediate different interactions

  • Detergent selection is critical for maintaining protein structure during purification

Systematic identification of ExoP interaction partners will provide crucial insights into the mechanism of succinoglycan polymerization and export.

What expression systems are optimal for producing recombinant ExoP for structural studies?

Producing sufficient quantities of properly folded ExoP for structural studies presents significant challenges due to its membrane-associated nature. Recommended expression systems include:

  • E. coli-based systems with modifications:

    • C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • LEMO21(DE3) system for tunable expression levels

    • Fusion tags (MBP, SUMO) to enhance solubility

  • Rhizobial expression systems:

    • Homologous expression in R. meliloti for native folding

    • Inducible promoters to control expression levels

  • Cell-free expression systems:

    • Supplemented with appropriate lipids and detergents

    • Allows direct incorporation into nanodiscs or liposomes

Key considerations for purification:

  • Extraction using mild detergents (DDM, LMNG) to maintain native conformation

  • Affinity chromatography using engineered tags

  • Size exclusion chromatography to ensure homogeneity

  • Quality control using circular dichroism to verify proper folding

For structural studies specifically, researchers should consider:

  • Expressing individual domains separately (especially the cytoplasmic domain)

  • Using nanodiscs or amphipols for maintaining membrane domain structure

  • Optimizing conditions for crystallization or cryo-EM analysis

What assays can be used to measure ExoP ATPase and autophosphorylation activities?

To characterize the enzymatic activities of ExoP, researchers should employ the following methodological approaches:

For ATPase activity:

  • Malachite green phosphate assay: Colorimetric detection of inorganic phosphate released during ATP hydrolysis

  • Coupled enzyme assay: Using pyruvate kinase and lactate dehydrogenase to couple ATP hydrolysis to NADH oxidation

  • Radioactive [γ-³²P]ATP assay: Direct measurement of released ³²Pi

For tyrosine autophosphorylation:

  • Western blot with anti-phosphotyrosine antibodies: Detect phosphorylated tyrosine residues

  • Phos-tag SDS-PAGE: Separate phosphorylated from non-phosphorylated ExoP

  • Mass spectrometry: Identify specific phosphorylated residues

  • Radioactive [γ-³²P]ATP incorporation: Quantitative measurement of autophosphorylation

Experimental design considerations:

  • Control reactions with known ATPase inhibitors

  • Site-directed mutants of key residues (Walker A motif, specific tyrosines)

  • Testing activity under varying conditions (pH, ionic strength, presence of metal ions)

  • Correlation of in vitro activity measurements with in vivo phenotypes

These assays provide quantitative measures of ExoP enzymatic functions, essential for understanding how mutations affect protein activity and subsequently influence succinoglycan biosynthesis.

How can researchers resolve contradictory findings regarding ExoP function?

Contradictory findings regarding ExoP function, such as divergent symbiotic phenotypes resulting from different exoP mutations , require systematic approaches to resolve:

  • Standardize experimental conditions: Ensure consistent:

    • Bacterial growth conditions (medium, temperature, growth phase)

    • Osmolarity levels, which significantly affect succinoglycan production

    • Methods for quantifying succinoglycan and characterizing symbiotic phenotypes

  • Comprehensive mutation analysis:

    • Create a library of mutations targeting specific domains and motifs

    • Characterize each mutation's effect on multiple parameters (ATPase activity, tyrosine phosphorylation, protein interactions, succinoglycan production, symbiotic phenotype)

    • Look for patterns that explain apparent contradictions

  • Consider genetic background effects:

    • Different R. meliloti strains may show varying phenotypes with identical exoP mutations

    • Secondary mutations may compensate for exoP defects in some experimental systems

  • Employ systems biology approaches:

    • Transcriptomics to identify genes differentially expressed in various exoP mutants

    • Metabolomics to detect changes in relevant metabolic pathways

    • Integrative modeling to understand complex relationships between observed phenotypes

When contradictory findings persist, consider that ExoP may have multiple functions beyond succinoglycan biosynthesis, or that experimental artifacts may be contributing to observed discrepancies.

What statistical approaches are recommended for analyzing structure-function relationships in ExoP mutants?

When analyzing structure-function relationships in ExoP mutants, researchers should employ robust statistical approaches:

  • Multivariate analysis methods:

    • Principal Component Analysis (PCA) to identify patterns across multiple parameters

    • Hierarchical clustering to group mutants with similar functional profiles

    • Partial Least Squares Regression to correlate structural features with functional outcomes

  • Quantitative structure-function modeling:

    • Multiple regression models relating amino acid properties to functional parameters

    • Machine learning approaches to predict functional outcomes from sequence features

    • Molecular dynamics simulations correlated with experimental data

  • Experimental design considerations:

    • Use factorial experimental designs to test interactions between mutations

    • Include biological replicates (minimum n=3) for all experiments

    • Employ appropriate controls (wild-type, known functional mutants)

  • Significance testing and validation:

    • ANOVA with post-hoc tests for comparing multiple mutants

    • Bootstrap methods for estimating confidence intervals

    • Cross-validation of predictive models

These statistical approaches enable researchers to move beyond simple correlation to develop mechanistic models that explain how specific structural features of ExoP contribute to its various functions in succinoglycan biosynthesis.

How should researchers interpret changes in succinoglycan molecular weight distribution in the context of symbiotic efficiency?

Interpreting changes in succinoglycan molecular weight distribution requires a nuanced approach that considers the complexity of symbiotic interactions:

  • Establish correlation patterns:

    • Track both molecular weight distribution (HMW:LMW ratio) and symbiotic parameters (nodule number, nitrogen fixation efficiency)

    • Look for non-linear relationships, as optimal symbiosis may require specific ratios rather than maximum/minimum values

  • Consider the trimer hypothesis:

    • The finding that trimers of octasaccharide subunits are the symbiotically active species suggests focusing specifically on this fraction

    • Quantify the absolute amount of trimers produced, not just relative proportions

  • Examine environmental context:

    • Test symbiotic efficiency under varying environmental conditions (drought, salinity)

    • Assess whether different molecular weight distributions provide advantages in specific environments

  • Integrate with microbiological parameters:

    • Correlate succinoglycan profiles with bacterial survival, colonization efficiency, and competitive ability

    • Consider whether changes in succinoglycan affect biofilm formation or other behaviors

Interpretation framework table:

Succinoglycan ProfileTypical Symbiotic OutcomeAlternative Interpretations
High LMW, low HMWEnhanced infection thread formationPossible susceptibility to environmental stress
High HMW, low LMWEnhanced biofilm formation, stress resistancePossible reduced infection efficiency
Only monomers presentSeverely impaired symbiosisSome mutations may allow alternative mechanisms
No detectable EPS ITypically no symbiosisSome exoP mutants can establish effective symbiosis

This framework helps researchers move beyond simplistic correlations to develop mechanistic understanding of how ExoP-mediated regulation of succinoglycan biosynthesis influences the complex process of symbiotic nitrogen fixation.

What are the most promising avenues for advancing our understanding of ExoP function?

Based on current knowledge gaps and technological capabilities, the following research directions offer significant potential for advancing our understanding of ExoP function:

  • Structural biology approaches:

    • Determining the crystal structure of the cytoplasmic domain with and without bound ATP

    • Cryo-EM studies of full-length ExoP in membrane environments

    • Structural analysis of ExoP in complex with interaction partners

  • Systems-level analysis:

    • Comprehensive interactome mapping to identify all ExoP protein interactions

    • Global phosphoproteomic analysis to characterize ExoP phosphorylation under different conditions

    • Integrative multi-omics approaches to understand ExoP's role in the broader cellular context

  • In situ characterization:

    • Advanced microscopy techniques to visualize ExoP localization and dynamics during succinoglycan biosynthesis

    • Single-molecule tracking to understand ExoP mobility and clustering

    • FRET-based sensors to monitor ExoP conformational changes in living cells

  • Synthetic biology approaches:

    • Engineering chimeric ExoP proteins with domains from related organisms

    • Creating minimal synthetic systems for succinoglycan biosynthesis

    • Controlled expression systems to tune ExoP levels and study dosage effects

These approaches, particularly when used in combination, have the potential to resolve outstanding questions about ExoP function and provide a comprehensive model of succinoglycan biosynthesis regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.