Recombinant Rhizobium meliloti Type I secretion system ATP-binding protein PrsD (prsD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
prsD; RB1292; SM_b21466; Type I secretion system ATP-binding protein PrsD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
prsD
Target Protein Sequence
MATSKGRNADPAAALRDCRAAFIGVGVASALVNLLYLTGSFFMLEVYDRILPSRSIPSLI ALSLLALLLYAFQGAFELIRGRMLVRIAGALDESLNGRIYRAIVKAPLKLRMQGDGLQAL RDFDQVRSFLSGVGPAALFDLPWLPFYIAICFLFHPVIGLIAIIGGLILTLLTYLTNRGT QAPAKKASEAGGLRNVFAQASQRNAEVVHAMGMSARLTALWERRNTEFRDENRRTSDIGN GYGALSKVFRMALQSGVLAAGAVLVIRGEASPGIIIAGSILTARALAPVELAIGNWRGLV AARQSWQRLKELLNALPEADAPLQLPDPHERLTVEGLASGPPAAQRLVVSDVNFTVRAGG AVGVIGPSASGKSSLARAILGIWPAYRGSVRLDGAALDQWDSDALGKHVGYLPQDVELFA GTIAQNICRFAEDATSEAIVAAAKAARVNDLILRLPNGYDTEIGDGGMTLSAGQRQRVAL ARALYGDPFLVVLDEPNSNLDAEGEQALSEAIMSVRSRGGIVIVVAHRPSALASVDLVLM MNEGRMQAFGPKEQVLGQVLRPQQVERQNALKVVAEGQEAKQ
Uniprot No.

Target Background

Function
Mediates the secretion of the glycanase ExsH.
Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of PrsD in Rhizobium meliloti?

PrsD functions as an ATP-binding protein component of a Type I secretion system in Rhizobium meliloti (also known as Sinorhizobium meliloti). It works in conjunction with PrsE to form a secretion apparatus that exports specific proteins outside the cell. Specifically, the PrsD/PrsE complex forms a critical component of a secretion pathway that exports ExsH, a succinoglycan depolymerase with glycine-rich nonameric repeats typical of proteins secreted by Type I secretion systems .

To investigate PrsD function experimentally, researchers should employ gene deletion and complementation studies. Create a prsD knockout mutant through targeted gene deletion, then compare phenotypes (particularly succinoglycan processing) between wild-type and mutant strains. For complementation, reintroduce the prsD gene on a plasmid to confirm phenotype restoration. Fluorescent tagging of PrsD can also help visualize its cellular localization using confocal microscopy.

How does the PrsD/PrsE/ExsH pathway differ from the ExoK pathway in succinoglycan processing?

The PrsD/PrsE/ExsH and ExoK pathways represent independent mechanisms for producing extracellular succinoglycan-degrading activities in Rhizobium meliloti. When examining colonies on medium containing the succinoglycan-binding dye Calcofluor under UV light, exoK mutants produce fluorescent halos with delayed onset compared to wild-type colonies . The eventual production of these halos in exoK mutants depends on the intact functioning of the prsD, prsE, and exsH genes.

To distinguish between these pathways experimentally:

  • Create single and double mutants (exoK, prsD, prsE, exsH, and combinations)

  • Perform Calcofluor halo assays on solid media

  • Quantify low-molecular-weight succinoglycan production using gel filtration chromatography

  • Measure extracellular glycanase activity using enzymatic assays with appropriate substrates

The distinct temporal patterns of halo formation and the biochemical characteristics of the processed succinoglycan provide evidence of parallel but non-redundant pathways for polysaccharide processing .

What expression systems are suitable for producing recombinant PrsD protein?

When selecting an expression system for recombinant PrsD production, consider the following methodological approaches:

  • E. coli-based systems: For initial characterization, BL21(DE3) with a pET vector system offers tight regulation and high expression. Add a His-tag for purification and optimize induction conditions (IPTG concentration, temperature, duration) to maximize soluble protein yield.

  • Native expression: For functional studies, consider expressing PrsD in Rhizobium meliloti under its native promoter or an inducible promoter system compatible with rhizobial biology.

  • Expression optimization: To improve yield and solubility:

    • Test multiple fusion tags (His, GST, MBP, SUMO)

    • Optimize growth temperature (typically lower temperatures of 16-25°C improve folding)

    • Co-express with PrsE and/or chaperones to facilitate proper folding

  • Verification methods: Confirm expression using:

    • SDS-PAGE with Coomassie staining

    • Western blotting with anti-His or custom anti-PrsD antibodies

    • Activity assays examining ATP binding/hydrolysis

When developing purification protocols, consider that as an ABC transporter component, PrsD likely contains hydrophobic regions that may affect solubility in aqueous buffers.

How can statistical design of experiments (SDOE) improve research on PrsD function compared to pseudo-random sequence designs?

When investigating PrsD function in complex biological systems, experimental design significantly impacts data quality and interpretability. Statistical design of experiments (SDOE) offers substantial advantages over pseudo-random sequence designs (PRSD) for studying nonlinear biological systems like the PrsD/PrsE/ExsH secretion pathway.

Research shows that SDOE is dramatically more efficient than PRSD approaches, with PRSD designs achieving only 3.3-17.2% efficiency compared to SDOE when estimating all parameters in nonlinear systems . This efficiency gap is even more pronounced when estimating steady-state parameters, where PRSD designs may achieve only 1.5-6.0% efficiency relative to SDOE .

For PrsD research, implement SDOE by:

  • Identifying key factors affecting PrsD function (e.g., expression levels, ATP concentration, temperature, pH)

  • Defining factor levels systematically rather than randomly

  • Designing experiments with orthogonal factor combinations

  • Including sufficient steady-state measurements to accurately characterize PrsD kinetics

  • Running step tests with sufficient duration at each level to reach equilibrium

This approach ensures comprehensive coverage of the experimental space and reduces confounding between factors, particularly important when studying ATP binding, protein-protein interactions, and secretion kinetics in the PrsD/PrsE system.

What analytical techniques provide optimal validation when studying PrsD-dependent secretion?

When validating methods for studying PrsD-dependent secretion, researchers should follow Standard Method Performance Requirements (SMPRs) principles to ensure robust and reproducible results. For quantitative analysis of proteins secreted via the PrsD/PrsE system, consider the following validation parameters:

  • Method specificity: Demonstrate that the method specifically detects PrsD-dependent secreted proteins (e.g., ExsH) without interference from other secreted proteins.

  • Recovery expectations: Expected recovery percentages should align with analyte concentration ranges. For example, at concentrations of 0.001% (10 ppm), acceptable recovery ranges are 80-110% .

  • Reproducibility: Calculate the Predicted Relative Standard Deviation of Reproducibility (PRSDR) using the Horwitz formula: PRSDR = 2C^(-0.15), where C is the mass fraction of the analyte .

Analyte ConcentrationMass Fraction (C)Expected Recovery (%)PRSDR (%)
0.1%10^-395-105~5.6
0.01%10^-490-107~6.3
0.001% (10 ppm)10^-580-110~7.1
0.0001% (1 ppm)10^-680-110~8.0
0.00001% (100 ppb)10^-760-115~9.0
  • Sample size requirements: For detection methods evaluating PrsD functionality (e.g., secretion vs. no secretion), the minimum number of test portions needed depends on the desired probability of detection (POD). For example, to achieve a minimum probability of 50% with a lower confidence limit of 52.6%, at least 3 test portions with 3 positive events are required .

These validation parameters ensure that observations of PrsD-dependent secretion are reliable and reproducible across different laboratories and experimental conditions.

What approaches can resolve contradictory data when studying the interaction between PrsD and PrsE components?

When facing contradictory data regarding PrsD-PrsE interactions, a systematic troubleshooting approach is essential. Conflicting results may arise from differences in experimental conditions, protein preparation methods, or analytical techniques. Here's a methodological framework to resolve such discrepancies:

  • Characterize protein quality:

    • Verify protein folding using circular dichroism (CD) spectroscopy

    • Assess protein homogeneity via size-exclusion chromatography

    • Confirm ATPase activity of PrsD using malachite green phosphate assays

    • Verify membrane association properties of PrsE

  • Standardize interaction assays:

    • Compare direct binding methods (SPR, ITC, MST) with co-immunoprecipitation results

    • Test interactions in different buffer conditions (varying pH, salt concentration, detergents)

    • Examine binding in the presence/absence of ATP and its non-hydrolyzable analogs

    • Consider the influence of additional components (e.g., ExsH substrate)

  • Validate in vivo relevance:

    • Perform bacterial two-hybrid or split-GFP assays in living cells

    • Create point mutations in predicted interaction domains and assess their effects

    • Use cross-linking approaches to capture transient interactions

    • Develop FRET-based assays to monitor interactions in real-time

  • Data integration strategy:

    • Organize contradictory findings in a structured table highlighting methodological differences

    • Weight evidence based on methodological rigor and proximity to native conditions

    • Develop testable hypotheses that could explain apparent contradictions

    • Consider kinetic or conformational factors that might reconcile divergent observations

By systematically evaluating the methodological basis for contradictory results, researchers can distinguish between genuine biological complexity and technical artifacts in the PrsD-PrsE system.

How does the molecular structure of PrsD influence its ATP binding and hydrolysis in the Type I secretion system?

As an ATP-binding protein in a Type I secretion system, PrsD's structure contains conserved motifs that coordinate ATP binding and hydrolysis, driving the energy-dependent secretion process. While specific structural data for Rhizobium meliloti PrsD is limited, its function can be understood through homology with other ABC transporters.

To investigate structure-function relationships:

  • Structural prediction and analysis:

    • Generate homology models based on crystallized ABC transporters

    • Identify conserved Walker A (P-loop), Walker B, and ABC signature motifs

    • Use molecular dynamics simulations to predict ATP binding pocket conformational changes

    • Analyze potential interaction surfaces with PrsE and substrate proteins

  • Mutation-based functional studies:

    • Create site-directed mutations in key residues predicted to participate in:

      • ATP binding (typically conserved lysine in Walker A motif)

      • ATP hydrolysis (typically conserved aspartate in Walker B motif)

      • Dimer interface (ABC signature motif)

    • Measure effects on ATPase activity using colorimetric phosphate release assays

    • Assess impact on secretion using reporter proteins fused to ExsH signal sequences

  • ATP binding and hydrolysis characterization:

    • Determine ATP binding affinity using isothermal titration calorimetry (ITC)

    • Measure ATPase activity under various conditions (pH, temperature, ion concentrations)

    • Investigate cooperative effects between PrsD dimers using Hill plot analysis

    • Examine the influence of PrsE binding on ATPase kinetics

  • Energy coupling mechanism:

    • Analyze how ATP hydrolysis energy is transduced into mechanical force for secretion

    • Investigate conformational changes using limited proteolysis or hydrogen-deuterium exchange

    • Develop FRET-based assays to monitor real-time conformational changes during ATP binding/hydrolysis cycles

Through these approaches, researchers can establish how the molecular structure of PrsD coordinates ATP utilization to drive the secretion of proteins like ExsH through the Type I secretion system.

What are the optimal control conditions for PrsD functionality experiments?

When designing experiments to assess PrsD functionality, proper controls are essential for generating reliable and interpretable data. Consider implementing the following controls:

  • Genetic controls:

    • Wild-type R. meliloti strain (positive control for secretion)

    • PrsD deletion mutant (negative control for PrsD-dependent secretion)

    • PrsD deletion complemented with wild-type prsD gene (restoration control)

    • PrsD deletion complemented with ATPase-deficient prsD mutant (functional domain control)

  • Secretion substrate controls:

    • Known PrsD-dependent substrate (e.g., ExsH) with intact secretion signal

    • Modified substrate lacking secretion signal (negative control)

    • Non-cognate Type I secretion substrate (specificity control)

  • Biochemical assay controls:

    • ATP-binding/hydrolysis assays should include:

      • No-protein controls to establish baseline

      • Heat-inactivated protein controls

      • Known functional ABC transporter controls (e.g., purified maltose transporter)

      • ATPase inhibitor controls (e.g., vanadate, BeFx)

  • Expression controls:

    • Empty vector controls for expression studies

    • Housekeeping gene controls for normalization in transcription studies

    • Western blot controls with defined quantities of purified protein

When designing statistical aspects of PrsD experiments, SDOE approaches are strongly preferred over PRSD methods, as they have been shown to provide dramatically higher efficiency in parameter estimation for nonlinear systems .

How can researchers effectively analyze the kinetics of PrsD-mediated protein secretion?

Analyzing the kinetics of PrsD-mediated protein secretion requires methods that can capture both the rate and efficiency of the secretion process. Here's a methodological framework:

  • Time-course secretion analysis:

    • Culture R. meliloti strains (wild-type and mutants) in defined medium

    • Collect supernatant samples at regular intervals (e.g., 0, 15, 30, 60, 120, 240 min)

    • Concentrate proteins using TCA precipitation or ultrafiltration

    • Quantify secreted proteins via:

      • Western blotting (for specific known substrates)

      • SDS-PAGE with silver staining (for total secreted protein profile)

      • Mass spectrometry (for unbiased identification of all secreted proteins)

  • Kinetic parameter determination:

    • Calculate secretion rates during linear phase

    • Determine time to reach half-maximal secretion (t½)

    • Estimate maximal secretion capacity (Vmax)

    • Analyze the effect of substrate concentration on secretion rate

    • Perform Michaelis-Menten or Hill plot analysis if appropriate

  • Energetics analysis:

    • Measure ATP consumption during secretion using luciferase-based ATP assays

    • Calculate the ATP:protein ratio (energy cost per secreted molecule)

    • Investigate the effect of proton motive force disruption on secretion efficiency

    • Correlate ATPase activity with secretion rate under various conditions

  • Single-cell analysis:

    • Develop fluorescent substrate reporters to monitor secretion in real-time

    • Use microfluidic devices to track secretion at the single-cell level

    • Apply fluorescence recovery after photobleaching (FRAP) to study secretion dynamics

    • Correlate secretion with cellular parameters (growth rate, cell cycle stage)

The resulting dataset should be analyzed using appropriate statistical methods, preferably incorporating SDOE principles to maximize information content . This approach enables researchers to precisely determine the kinetic parameters of PrsD-mediated secretion and how they are affected by genetic or environmental perturbations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.