Recombinant Rhizobium meliloti Type I secretion system membrane fusion protein PrsE (prsE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its incorporation.
Synonyms
prsE; RB1291; SM_b21465; Type I secretion system membrane fusion protein PrsE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
prsE
Target Protein Sequence
MKGWLQQHKPTARRSLSRHLIGVSVLALALVAGVGGWAATTELSSAIVAGGVVIVDDNVK KVQHLTGGIVGELLVKEGDRVEAGQVLIRLDGTTVRANLAIIESTLAQFYARRARLQAER MGAASFEIEEDLAEFIPGTAAAKLIEGEQRLFASRRSALSGMKGQLDSRKAQLADEVEGL TVQLNAIEEALKLIAEELTGVDSLFGQGLVPMQRVTTLKRQRAELEGGRGRHIAARAQAR GKSSEIDLQILQLDEDRRSEISKELTDVEAKIAEYEERRTAATDQLRRLDITAPLSGRIY QLAIHTVNGVINPGETLMLVVPEAEDLTVEAKVATHDIDQIRVGQSVEIRFSAFNQRTTP EVEAEVVTVAPDLVTDERTGASYYPLRIRPKAESLAKLKGLSLYPGMPAEVFIKIADRTV ISYLTKPLTDQMRHAFRED
Uniprot No.

Target Background

Function
Mediates the secretion of the glycanase ExsH.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is PrsE in Rhizobium meliloti?

PrsE is a membrane fusion protein that forms an essential component of a Type I secretion system in Rhizobium meliloti. It functions in conjunction with PrsD, an ABC transporter homologue, to create a functional secretion apparatus for transporting proteins across the bacterial cell envelope . Membrane fusion proteins like PrsE typically serve as adaptor proteins that connect inner membrane transporters to outer membrane components, creating a continuous channel through which substrate proteins are secreted to the extracellular environment. PrsE is particularly significant for symbiotic nitrogen fixation and bacterial adaptation processes through its role in secreting proteins involved in exopolysaccharide modification and biofilm formation .

How does the PrsD-PrsE secretion system operate?

The PrsD-PrsE secretion system functions as a Type I secretion system, directly transporting proteins from the bacterial cytoplasm to the extracellular environment without periplasmic intermediates. PrsD acts as the ABC transporter component, providing energy for secretion through ATP hydrolysis, while PrsE functions as the membrane fusion protein that bridges the inner and outer bacterial membranes . Together with an outer membrane component (not specifically identified in the search results), these proteins form a continuous channel spanning both membranes. This system recognizes specific features in substrate proteins, likely including C-terminal secretion signals and structural motifs like glycine-rich repeats that are typically found in proteins secreted by Type I systems . The secretion process is typically one-step and sec-independent, allowing for the efficient export of proteins such as glycanases and other enzymes that modify bacterial exopolysaccharides .

What proteins are secreted through the PrsD-PrsE system?

The PrsD-PrsE Type I secretion system in Rhizobium species is responsible for the export of multiple proteins with diverse functions. In Rhizobium leguminosarum, at least nine proteins are secreted via this system . These include glycanases PlyA and PlyB that cleave acidic exopolysaccharide, the nodulation signaling protein NodO, and proteins RapA1, RapA2, and RapC that contain the Ra motif likely involved in exopolysaccharide binding . Additional proteins designated as EP145, EP77, EP59, EP32, and EP30.5 are also secreted and predicted to be calcium-binding proteins . In Rhizobium meliloti specifically, the system is involved in secreting ExsH, a succinoglycan depolymerase with glycine-rich nonameric repeats characteristic of Type I-secreted proteins . Together with ExoK (secreted through a different pathway), these glycanases contribute to the production of low-molecular-weight succinoglycan, which is important for symbiotic interactions .

What methods are used to assess PrsE-dependent protein secretion?

Several complementary methodological approaches are employed to assess PrsE-dependent protein secretion in Rhizobium species. Researchers typically separate extracellular proteins by SDS-PAGE followed by Coomassie blue staining to visualize and compare secreted protein profiles between wild-type and mutant strains . Enzymatic activity assays measuring glycanase activity using substrates such as carboxymethyl cellulose (CMC) provide functional assessments of secretion, with degradation detected through methods like Congo red staining . Exopolysaccharide modification can be visualized using Calcofluor binding and UV light observation to detect fluorescent halos around colonies, indicating exopolysaccharide production and processing . Biofilm formation assays using crystal violet staining of attached cells on polystyrene surfaces or direct observation of biofilm rings at liquid-air interfaces provide insights into the consequences of secretion defects . Additionally, secretion of specific proteins like NodO can be tracked through immunological techniques or specialized activity assays .

What are the structural features of proteins secreted via the PrsD-PrsE system?

Proteins secreted through the PrsD-PrsE Type I secretion system share several characteristic structural features that facilitate their recognition and secretion. Many secreted proteins (RapC, RapA1, RapA2, PlyB, and PlyA) contain a conserved motif called the Ra motif, which has been proposed to bind to components of exopolysaccharides . This shared binding domain likely reflects the functional role of these proteins in exopolysaccharide processing. Additionally, several secreted proteins (NodO, PlyB, PlyA, EP145, EP77, EP59, EP32, and EP30.5) display characteristics of calcium-binding proteins, which is a common feature of proteins secreted by Type I systems . In Rhizobium meliloti specifically, ExsH contains glycine-rich nonameric repeats that are typical of proteins secreted by Type I secretion systems . While not explicitly mentioned in the search results, Type I-secreted proteins typically contain C-terminal secretion signals rather than N-terminal signal sequences. These structural commonalities explain how a single secretion system can recognize and export multiple distinct proteins with diverse functions.

How does the PrsD-PrsE secretion system contribute to exopolysaccharide processing?

The PrsD-PrsE Type I secretion system plays a crucial role in exopolysaccharide (EPS) processing through the export of glycanases that modify EPS structure. In Rhizobium meliloti, the system is involved in secreting ExsH, a succinoglycan depolymerase that, together with ExoK (secreted through a different pathway), contributes to the production of low-molecular-weight succinoglycan . These enzymes are essential components of independent pathways for production of extracellular succinoglycan-degrading activities. In Rhizobium leguminosarum, the PrsD-PrsE system secretes PlyA and PlyB glycanases that cleave acidic EPS . When the secretion system is disabled in prsD or prsE mutants, the EPS produced is considerably longer than normal, indicating that these secreted enzymes are responsible for processing the EPS into shorter fragments . This processing appears to be precisely regulated, with PlyA and PlyB likely requiring nascent EPS synthesis for their activation, which limits EPS cleavage to regions adjacent to the bacterial surface . EPS processing is critical because the molecular weight and structure of EPS influence bacterial interactions with plants and environmental adaptation.

How does the PrsD-PrsE system affect biofilm formation?

The PrsD-PrsE Type I secretion system significantly impacts biofilm formation in Rhizobium species. Mutants defective in this secretion system (both prsD and prsE mutants) consistently produced greatly reduced rings of biofilm compared to wild-type strains at the liquid-air interface of shaken flask cultures . This observation led researchers to propose that proteins secreted via the PrsD-PrsE system play important roles in biofilm formation and maturation, suggesting that the primary role of this secretion system might be to export proteins associated with surface attachment and biofilm development . The secreted proteins likely influence different aspects of biofilm formation, including initial attachment to surfaces and subsequent maturation processes. The exopolysaccharide-modifying enzymes secreted through this system may alter surface properties of bacteria or modify the extracellular matrix components of biofilms, thereby affecting their structural integrity and development. This connection between protein secretion and bacterial community behavior highlights the multifaceted roles of the PrsD-PrsE system in bacterial adaptation to environmental conditions .

What is the relationship between PrsE-dependent secretion and symbiotic nitrogen fixation?

The relationship between PrsE-dependent secretion and symbiotic nitrogen fixation appears complex and multifaceted. The prsE mutant was able to induce nitrogen-fixing nodules on peas, whereas the prsD mutant formed non-nitrogen-fixing nodules . This suggests that the residual secretion activity in the prsE mutant is sufficient to support functional symbiosis, highlighting the importance of secreted proteins in the establishment of effective plant-microbe interactions. The PrsD-PrsE system secretes NodO, a nodulation signaling protein involved in the symbiotic process . Researchers suggested that perhaps the secretion system has been "hijacked" to allow export of this symbiosis-specific protein . Additionally, the modification of exopolysaccharides by secreted glycanases likely influences bacterial-plant interactions, as EPS plays important roles in infection thread formation and other aspects of the symbiotic process. The molecular weight of succinoglycan, modulated by secreted glycanases like ExsH, has been implicated in successful invasion of plant tissues and establishment of symbiosis .

What molecular mechanisms govern substrate recognition by the PrsD-PrsE secretion system?

The molecular mechanisms by which the PrsD-PrsE Type I secretion system recognizes and selects its substrate proteins involve specific structural features and recognition signals. Unlike many Type I systems that secrete only one or a few related proteins, the PrsD-PrsE system exports at least nine different proteins . This unusual substrate range appears to be enabled by shared structural features among these diverse proteins. Many contain the Ra motif proposed to bind to exopolysaccharide components, and several are calcium-binding proteins . These common features might play a role in substrate recognition by the secretion apparatus. In the case of ExsH from R. meliloti, glycine-rich nonameric repeats typical of Type I-secreted proteins were identified , which likely contribute to recognition. Although not explicitly mentioned in the search results, Type I secretion systems typically recognize C-terminal secretion signals in their substrates, and this is likely true for the PrsD-PrsE system as well. The unusual diversity of substrates suggests that the PrsD-PrsE system may have evolved broader substrate recognition capabilities than other Type I secretion systems.

What techniques can be used to study PrsE structure-function relationships?

Investigating the structure-function relationship of PrsE requires a comprehensive approach combining molecular genetics, biochemistry, and structural biology. Domain mapping through systematic creation of PrsE variants with deletions or targeted mutations can identify regions essential for interactions with PrsD, outer membrane components, and substrate proteins. Protein-protein interaction studies using bacterial two-hybrid systems, co-immunoprecipitation, or surface plasmon resonance can characterize interactions between PrsE and other secretion system components . Structural analyses using X-ray crystallography or cryo-electron microscopy would provide high-resolution structural information about PrsE alone or in complex with partners. Chemical cross-linking followed by mass spectrometry can identify regions of PrsE that are in close proximity to other components during the secretion process. In vivo functionality assays testing the ability of PrsE variants to complement prsE mutants for phenotypes such as protein secretion, glycanase activity, or biofilm formation can provide functional context for structural findings . The observation that prsE mutants retain some residual glycanase activity suggests that comparative analysis with potential compensatory membrane fusion proteins could reveal key functional domains .

Efficient expression and purification of recombinant PrsE presents challenges typical of membrane-associated proteins but can be approached through several strategies. Expression systems should be carefully selected, with E. coli being a common choice, though homologous expression in Rhizobium might preserve native folding. The use of fusion tags (His, GST, MBP) can facilitate purification while potentially enhancing solubility. For membrane-associated proteins like PrsE, inclusion of appropriate detergents during cell lysis and purification is critical to maintain protein structure and function. Strategies to express soluble domains of PrsE separately might circumvent challenges associated with full-length membrane protein expression. Purification protocols typically involve affinity chromatography followed by size exclusion and/or ion exchange chromatography to achieve high purity. Quality control assessments through circular dichroism spectroscopy can confirm proper folding, while dynamic light scattering evaluates sample homogeneity. Activity assays measuring interaction with PrsD or substrate proteins would validate functional integrity of the purified protein. Though specific methods for PrsE purification are not detailed in the search results, these approaches represent standard practices for membrane fusion proteins in Type I secretion systems.

What approaches can be used to identify the complete secretome of the PrsD-PrsE system?

Comprehensive identification of all proteins secreted via the PrsD-PrsE system requires integrated proteomic and genomic approaches. Comparative secretome analysis is fundamental, involving collection of extracellular proteins from wild-type and secretion system mutants, followed by high-resolution mass spectrometry to identify differentially secreted proteins . The search results indicate that researchers identified several secreted proteins using this approach, including PlyA, PlyB, and multiple others designated by their apparent molecular weights (EP145, EP77, etc.) . N-terminal sequencing of isolated secreted proteins provides crucial information for gene identification. Bioinformatic prediction can be employed to search genomes for proteins with characteristics typical of Type I-secreted proteins, including C-terminal secretion signals and structural features like the Ra motif or glycine-rich repeats identified in known substrates . Genetic approaches constructing reporter fusions with candidate secreted proteins can validate secretion predictions in vivo. Systematic mutagenesis of secreted proteins combined with functional assays for activities like glycanase function or biofilm formation helps establish biological relevance. Researchers noted challenges in this work due to genomic differences between strains, as the sizes of some proteins identified did not correspond to predicted gene products with matching N-terminal sequences .

How can the regulation of the PrsD-PrsE secretion system be investigated?

Understanding the regulation of the PrsD-PrsE secretion system requires investigation at multiple levels, from gene expression to protein activity. Transcriptional regulation can be studied using reporter gene fusions (lacZ, gfp) to prsD and prsE promoters to monitor expression under different environmental conditions and growth phases. RNA-seq analysis comparing expression profiles under various conditions can identify global regulatory networks affecting the secretion system. Chromatin immunoprecipitation can identify transcription factors binding to the promoter regions. Post-transcriptional regulation can be explored through analysis of mRNA stability and potential small RNA regulators. At the protein level, studies of protein stability, turnover, and potential modifications would reveal post-translational regulatory mechanisms. Environmental and physiological cues affecting secretion can be systematically tested, including pH, temperature, nutrients, and plant-derived signals. The search results suggest a potential connection between exopolysaccharide synthesis and secreted enzyme activity, as PlyB and PlyA likely require nascent EPS synthesis for their activation . This indicates complex regulatory mechanisms that coordinate secretion system activity with other cellular processes.

What experimental designs can assess the role of PrsE-dependent secretion in plant-microbe interactions?

Investigating the role of PrsE-dependent secretion in plant-microbe interactions requires multifaceted experimental approaches spanning molecular genetics, microscopy, and plant biology. Comparative nodulation assays using wild-type, prsD mutant, and prsE mutant strains on host plants can assess effects on symbiotic efficiency, with the search results showing that prsE mutants formed nitrogen-fixing nodules while prsD mutants did not . Microscopic examination of infection thread formation and development using fluorescently labeled bacteria can reveal specific stages affected by secretion defects. Electron microscopy of plant-microbe interfaces can visualize structural details of the interaction. The search results indicate that exopolysaccharide processing by secreted enzymes affects biofilm formation , suggesting that biofilm assays on plant surfaces would be informative. Isolation and characterization of exopolysaccharides from wild-type and mutant strains, followed by plant response assays to these purified fractions, can link specific EPS structures to plant recognition. Competition experiments between wild-type and secretion mutants for nodule occupancy would reveal subtle advantages conferred by the secretion system. Transcriptomic and metabolomic analyses of both bacterial and plant partners during interaction can identify regulatory networks and metabolic responses influenced by secreted proteins.

What are the current limitations in our understanding of the PrsE-dependent secretion mechanism?

Despite significant progress, several knowledge gaps limit our comprehensive understanding of PrsE-dependent secretion. The precise molecular architecture of the complete PrsD-PrsE secretion apparatus remains unresolved, with the outer membrane component not clearly identified in the search results. The exact recognition mechanism between the secretion system and its diverse substrates is incompletely understood, with uncertainty about whether recognition involves common structural motifs, specific C-terminal sequences, or a combination of factors . The search results indicate that the prsE mutant retains some glycanase activity unlike the prsD mutant , suggesting potential functional redundancy or compensation by other membrane fusion proteins, but these alternative components remain unidentified. The regulatory mechanisms controlling expression and activity of the secretion system under different environmental conditions and developmental stages are largely unknown. Furthermore, the evolutionary history of this secretion system and how it came to export both symbiosis-specific proteins like NodO and more general proteins involved in exopolysaccharide processing represents an intriguing question. The researchers suggested that the system may have been "hijacked" to allow export of NodO , but the evolutionary steps in this process remain to be elucidated.

How might insights from PrsE research be applied to biotechnological applications?

Research on the PrsD-PrsE secretion system offers several potential biotechnological applications. The system's ability to secrete diverse proteins with different functions suggests it could be engineered as a platform for heterologous protein production and secretion. By identifying the minimal recognition signals required for secretion, researchers could design fusion proteins combining these signals with proteins of interest for direct secretion to culture medium, simplifying downstream purification processes. The secretion system's role in exopolysaccharide modification could be exploited for engineering bacterial biofilms with desired properties for applications in bioremediation, biocontrol, or biofertilization. The connection to symbiotic nitrogen fixation suggests potential applications in developing improved biofertilizers with enhanced colonization capabilities. The understanding of how secreted glycanases modify exopolysaccharides could lead to enzymatic tools for specific polysaccharide modifications in industrial or medical applications. Additionally, knowledge of the structure-function relationships in this secretion system could contribute to broader protein engineering efforts aimed at creating novel secretion capabilities in various bacterial hosts for synthetic biology applications.

What comparative insights can be gained from studying PrsE homologs across different Rhizobium species?

Comparative analysis of PrsE homologs across different Rhizobium species can provide valuable insights into evolution, function, and host-microbe interactions. The search results indicate different phenotypic consequences of PrsD-PrsE system mutations in R. meliloti versus R. leguminosarum, particularly regarding symbiotic effectiveness , suggesting species-specific adaptations of the secretion system. By comparing the protein sequences and structures of PrsE homologs, conserved domains essential for basic secretion functions can be distinguished from variable regions potentially involved in species-specific interactions or substrate recognition. Analysis of the genes encoding secreted proteins across species can reveal how the secretome has evolved alongside the secretion system, potentially correlating with host range or environmental niches. The search results show that even within R. leguminosarum, identifying proteins corresponding to secreted protein sequences was sometimes challenging due to strain differences , highlighting the importance of strain-level comparisons. Examination of regulatory mechanisms across species could reveal common principles and specific adaptations in secretion system control. Furthermore, studying homologs in both symbiotic and non-symbiotic species could illuminate how this secretion system was adapted for symbiotic functions, testing the hypothesis that it was "hijacked" for secretion of symbiosis-specific proteins like NodO .

How does PrsE-dependent secretion integrate with other cellular processes?

The PrsE-dependent secretion system is integrated with multiple cellular processes, creating a complex network of interactions. The search results indicate a clear connection with exopolysaccharide biosynthesis, as secreted enzymes modify EPS structure, and their activity appears to be coordinated with EPS synthesis . This suggests regulatory links between secretion and the pathways controlling EPS production. The system's involvement in biofilm formation connects it to cell-cell communication systems like quorum sensing that typically regulate biofilm development. The secretion of NodO and its role in symbiosis implies integration with symbiotic signaling networks that respond to plant-derived molecules and coordinate nodulation processes. The differential phenotypes of prsD versus prsE mutants in symbiosis suggest complex interactions with other secretion or transport systems that might partially compensate for prsE deficiency. Membrane fusion proteins like PrsE must also interact with membrane biogenesis and maintenance pathways to ensure proper localization and function. Energy requirements for Type I secretion suggest connections to cellular energetics and ATP homeostasis. Future research using systems biology approaches including transcriptomics, proteomics, and interactomics would help map these integrated networks more comprehensively.

What novel technologies could advance our understanding of PrsE function?

Emerging technologies across multiple disciplines could significantly advance our understanding of PrsE function and the PrsD-PrsE secretion system. Cryo-electron microscopy advances now enable visualization of membrane protein complexes in near-native states, potentially revealing the complete architecture of the PrsD-PrsE secretion apparatus and its conformational changes during the secretion process. Single-molecule tracking microscopy could visualize the dynamics of secretion in real-time, providing insights into the kinetics and spatial organization of secretion events. CRISPR-Cas9 genome editing allows precise modification of prsE and related genes, facilitating detailed structure-function studies through targeted mutations. Proximity labeling techniques like BioID could identify transient interaction partners of PrsE during secretion. Microfluidic devices coupled with time-lapse microscopy would enable observation of single-cell secretion dynamics and heterogeneity in bacterial populations. Advanced bioinformatics using machine learning approaches could improve prediction of secretion substrates and regulatory networks. Synthetic biology approaches could create minimal secretion systems to define essential components. Plant-microbe interaction chambers with real-time imaging capabilities would connect molecular mechanisms to cellular behaviors during symbiosis. These technological advances would collectively provide unprecedented insights into the molecular mechanisms, regulation, and biological significance of PrsE-dependent secretion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.