Recombinant Rhizobium meliloti Tyrosinase (mepA)

Shipped with Ice Packs
In Stock

Description

Introduction to Rhizobium meliloti Tyrosinase (mepA)

Rhizobium meliloti Tyrosinase (mepA) is a copper-containing enzyme encoded by the mepA gene, which is linked to melanin biosynthesis in the soil bacterium Rhizobium meliloti GR4. This enzyme catalyzes the oxidation of L-tyrosine to L-dihydroxyphenylalanine (L-DOPA) and subsequent dopaquinone, initiating melanin polymerization . The mepA gene resides on the nonsymbiotic plasmid pRmeGR4b, distinguishing it from symbiotic functions in this nitrogen-fixing bacterium . Recombinant expression of mepA has enabled large-scale production for industrial and biotechnological applications.

Gene Structure and Regulation

  • The mepA gene is part of a melanin biosynthesis operon on plasmid pRmeGR4b .

  • It shares 54% DNA sequence identity with tyrosinases from Streptomyces antibioticus and Pseudomonas maltophila, with conserved copper-binding histidine residues critical for catalytic activity .

  • Expression in native hosts is regulated by plasmid-borne promoters, while recombinant systems (e.g., E. coli) often use inducible promoters like lacZ or tac .

Sequence Homology

A BLAST analysis reveals conserved regions in mepA:

FeatureSequence (Conserved Region)Role
Copper-binding site 1H-X-X-HSubstrate coordination
Copper-binding site 2H-X-X-HOxygen activation

Host Systems

  • Escherichia coli: The mepA gene has been cloned into vectors like pUC18 and pKK232-8, achieving melanin yields up to 9-fold higher than native R. meliloti .

  • Vibrio natriegens: Engineered strains with mepA produce melanin at rates of 0.15 mg/ml/hour, surpassing traditional systems .

Key Findings

  • Recombinant mepA expression in E. coli HB101/pAWS1 increased melanin production by 70.6% compared to native promoters .

  • Enzyme activity is suppressed by glucose (catabolite repression) and enhanced by nitrogen-rich media (e.g., peptone) .

Catalytic Activity

  • Substrates: Exhibits dual activity:

    • Tyrosine hydroxylase (TH): Converts L-tyrosine to L-DOPA (kcat=1.2×103min1k_{cat} = 1.2 \times 10^3 \, \text{min}^{-1}) .

    • DOPA oxidase (DO): Oxidizes L-DOPA to dopaquinone (Km=0.5mMK_m = 0.5 \, \text{mM}) .

  • Optimal Conditions:

    • pH 5.0 (TH activity), pH 7.0 (DO activity) .

    • Activated by SDS (0.05% w/v) .

Melanin Characteristics

PropertyValue/DescriptionSource
Yield in E. coli1.15 g melanin/g tyrosine
UV ProtectionAbsorbs 85% UV-A/B
Nanoparticle Size50–200 nm

Bioremediation

  • Melanin from recombinant mepA adsorbs toxic compounds like trinitrotoluene (TNT) with >90% efficiency .

Biomaterials

  • Used in UV-protective coatings and conductive nanomaterials due to its redox activity .

Agricultural Significance

  • Melanin enhances R. meliloti survival under oxidative stress, potentially improving symbiotic nitrogen fixation in legumes .

Comparative Analysis with Other Tyrosinases

ParameterR. meliloti mepABacillus megaterium Tyr1Streptomyces spp.
Melanin Yield (g/L)1.150.80.5
Optimal Temperature (°C)303728
Recombinant HostE. coli, VibrioE. coliStreptomyces

Challenges and Future Directions

  • Stability: Recombinant mepA loses 40% activity after 5 cycles in immobilized systems .

  • Scalability: High melanin yields in Vibrio natriegens suggest potential for industrial fermentation .

Product Specs

Form
Lyophilized powder. We will ship the available format, but you can specify your preference when ordering.
Lead Time
Delivery time varies by purchase method and location. Contact your local distributor for details. Proteins are shipped with blue ice packs by default. Request dry ice in advance for an extra fee.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening. Reconstitute protein in sterile deionized water to 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer, temperature, and protein stability. Liquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you have a specific tag preference, please inform us and we will prioritize its development.
Synonyms
mepA; melA; Tyrosinase; EC 1.14.18.1; Monophenol monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Purity
>85% (SDS-PAGE)
Species
Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
mepA
Target Protein Sequence
MTSADGQKDLQSYMDAVTAMLKLPPSDRRNWYRNGFIHLMDCPHGDWWFTSWHRGYLGYF EETCRELSGNPDFALPYWDWTANPEVLPPLFGTILDPVNSSAYIPDHNRFQDIMQEPIKA YWDSLSPAQLQQQNLRGYPDFDALWSDAMASFANQPNARFLTAQNPKLNPATQTAVDIDT IKASLAPTTFANDAGAPGLAFNSPVSSSHQVAPVGFSILEGQPHNRVHMSVGGQSAPYGL MSQNLSPLDPIFFLHHCNIDRLWDVWTRKQQAMGLPVGPTADQQTQYDPEPYLFYVNADG SPVSDKTRAADYLEIGDFDYDYDPGSGEEVIPVATAGRSAPIPALEAAVSASAAVAINKP ATAKLTVSQELVDVAAKPSEQSRQFAKVSIAPPMDVGGLNFLVFISPEGTTPDLNPDGPD FAGSFEFFGVRHHHTDTVSFTIPIDKALDRLIDDGRLKAGEPIDFAVVVAQEGKRVEGSM PAKAQLTDIQVGSF
Uniprot No.

Q&A

What is the genetic location of the mepA gene in Rhizobium meliloti GR4?

The mepA gene responsible for melanin production in R. meliloti GR4 is located on the nonsymbiotic plasmid pRmeGR4b (140 MDa). This genetic linkage has been confirmed through experiments where transfer of this plasmid to GR4-cured derivatives or to Agrobacterium tumefaciens enabled these bacteria to produce melanin. The physical location of the mep locus was identified through analysis of clones from a gene library of plasmid pRmeGR4b, revealing one recombinant plasmid (pRmNT111) containing the tyrosinase gene .

What is the molecular structure of the mepA gene and its protein product?

Sequence analysis of a 3.5-kb PstI fragment of plasmid pRmeGR4b revealed the presence of a 1,481-bp open reading frame that codes for the mepA protein. This protein shows strong homology to two conserved regions involved in copper binding in tyrosinases and hemocyanins. In vitro-coupled transcription-translation experiments demonstrated that this open reading frame codes for a 55-kDa polypeptide. The mepA gene can be expressed in Escherichia coli under the control of the lacZ promoter .

The physical map of the 3.5-kb PstI fragment of pRmeGR4b has been characterized, containing the mepA gene along with other open reading frames (ORF1 and ORF2) .

Why was the gene name changed from "mel" to "mep"?

The change from "mel" to "mep" (for melanin production) was proposed to avoid confusion with mel genes that code for melibiose metabolism in bacteria. This nomenclature change helps researchers distinguish between genes involved in melanin production and those involved in sugar metabolism, particularly when conducting literature searches or discussing gene function .

How is melanin production regulated in R. meliloti GR4 compared to other Rhizobium species?

Unlike in R. leguminosarum bv. phaseoli 8002, melanin production in R. meliloti GR4 is not under the control of the RpoN-NifA regulatory system. This was demonstrated by introducing plasmid pRmeGR4b or pRmNT111 into various mutant strains. Specifically, nifA, ntrC, or ntrA mutants of R. meliloti 2011 (a non-melanin producer) still produced melanin when the mepA gene was introduced, confirming that these regulatory systems are not required for mepA expression in GR4 .

This regulatory difference represents an important divergence in the control mechanisms of melanin synthesis among Rhizobium species and may reflect adaptation to different ecological niches or symbiotic relationships.

What is the relationship between mepA expression and symbiotic properties in R. meliloti GR4?

Studies with mutant strains have shown that mutations affecting melanin production do not impact the symbiotic properties of R. meliloti GR4. All tested mutant strains were able to induce effective symbiosis with alfalfa and showed a Fix+ phenotype (able to fix nitrogen). This suggests that while the mepA gene is carried on a plasmid in R. meliloti GR4, its expression is not directly linked to the bacterium's ability to form nitrogen-fixing symbioses with host plants .

This separation of melanin production and symbiotic function indicates that the mepA gene may serve other ecological functions for the bacterium, possibly related to stress protection or competition in the soil environment.

How do copper-binding regions in mepA influence tyrosinase activity?

The mepA gene encodes a protein with strong homology to conserved regions involved in copper binding in tyrosinases and hemocyanins. These copper-binding regions are crucial for the enzyme's catalytic activity. Tyrosinase is a copper-containing enzyme that catalyzes the oxidation of phenolic compounds to quinones, which subsequently polymerize to form melanin.

Experimental evidence from related tyrosinases suggests that the copper binding is highly pH-dependent, with activity significantly affected by changes in pH. This is supported by studies of other tyrosinases where copper treatment readily recovers enzyme activity in vitro. The importance of copper for tyrosinase activity explains why melanin synthesis in R. meliloti GR4 can be intensified by the addition of CuSO₄ along with the substrate L-tyrosine .

What is the relationship between plasmid transfer and melanin production in different bacterial hosts?

Transfer experiments with plasmid pRmeGR4b have demonstrated that this plasmid is sufficient to confer melanin production capability to non-melanin-producing bacteria. When transferred to GR4-cured derivatives or to Agrobacterium tumefaciens, the recipient bacteria gained the ability to produce melanin. Similarly, the recombinant plasmid pRmNT111, which contains the mepA gene, was able to induce melanin synthesis in a Mep- background, confirming that no other regions of the plasmid are necessary for melanin production .

This transferability of melanin production via plasmid conjugation has important implications for horizontal gene transfer in soil bacteria and demonstrates the modular nature of this metabolic capability.

What are the optimal conditions for detecting and measuring tyrosinase activity in R. meliloti?

Tyrosinase activity in R. meliloti can be detected using several complementary approaches:

  • Gel-based activity assay: Tyrosinase activity can be detected by gel incubation in 0.5 M phosphate buffer (pH 6.8) with L-tyrosine (600 μg/ml) and CuSO₄ (40 μg/ml) at 28°C in the dark with continuous shaking. The activity band typically becomes visible within minutes .

  • Colony melanization: Melanin synthesis can be observed in aged colonies on TY medium. The process can be intensified by the addition of L-tyrosine and CuSO₄ and accelerated by lysis with SDS .

  • In vitro L-DOPA oxidase activity assay: For quantitative measurement of tyrosinase activity, an in vitro L-DOPA oxidase activity assay can be performed. This involves monitoring the oxidation of L-DOPA spectrophotometrically .

For optimal results, researchers should maintain a pH around 6.8, include copper supplementation, and perform assays at 28°C for R. meliloti tyrosinase.

How can recombinant mepA be expressed and purified for biochemical studies?

For expression and purification of recombinant mepA, the following methodological approach is recommended:

  • Cloning strategy: The mepA gene can be amplified from R. meliloti GR4 plasmid pRmeGR4b and cloned into an expression vector with an inducible promoter (such as lacZ promoter, which has been demonstrated to work with mepA) .

  • Expression system: E. coli has been successfully used as a host for heterologous expression of mepA. The gene can be expressed under the control of the lacZ promoter .

  • Purification considerations: As a copper-containing enzyme, purification protocols should avoid strong chelating agents that might strip copper from the enzyme. Including copper supplementation during purification may help maintain enzyme activity.

  • Activity verification: Purified enzyme can be tested using the gel-based activity assay with L-tyrosine and CuSO₄ as described above .

This approach allows researchers to obtain purified mepA protein for detailed biochemical characterization, crystallography studies, or applied research.

What are the key considerations for designing mutation studies of the mepA gene?

When designing mutation studies for the mepA gene, researchers should consider:

  • Targeting copper-binding regions: Since the mepA protein contains conserved regions involved in copper binding that are essential for activity, these regions are prime targets for site-directed mutagenesis to understand structure-function relationships .

  • Plasmid vs. chromosomal context: Because mepA is plasmid-borne in R. meliloti GR4, mutation studies can be conducted either in the native plasmid context or after cloning into appropriate vectors for manipulation .

  • Phenotypic screening: Mutations affecting tyrosinase activity can be readily screened by observing changes in melanin production on tyrosine-supplemented media .

  • Regulatory element analysis: Although not under RpoN-NifA control, the regulatory elements of mepA expression remain to be fully characterized and represent important targets for mutation analysis .

  • Symbiotic impact assessment: While current evidence suggests no impact on symbiotic properties, comprehensive mutation studies should still assess effects on symbiosis with host plants to confirm this independence .

How can researchers distinguish between genuine tyrosinase activity and other phenoloxidase activities?

Distinguishing true tyrosinase activity from other phenoloxidase activities requires careful experimental design:

  • Substrate specificity: True tyrosinases act on both monophenols (e.g., tyrosine) and o-diphenols (e.g., L-DOPA), whereas laccases primarily oxidize o-diphenols and p-diphenols. Testing with multiple substrates can help differentiate these activities .

  • Inhibitor profile: Tyrosinase is selectively inhibited by certain compounds like kojic acid, while other phenoloxidases have different inhibitor profiles. A comparative inhibitor panel can help confirm tyrosinase activity .

  • Copper dependence: Tyrosinase activity is highly dependent on copper, with activity enhanced by CuSO₄ addition. This dependence can be used as a diagnostic feature when comparing different oxidase activities .

  • pH optima: Different phenoloxidases have characteristic pH optima, with tyrosinase typically showing peak activity around pH 6.5-7.0. pH activity profiles can help distinguish between enzyme classes .

The table below summarizes key distinctions between tyrosinase and other phenoloxidases:

ParameterTyrosinaseLaccasePeroxidase
SubstratesMonophenols and o-diphenolso-diphenols and p-diphenolsVarious, requires H₂O₂
Copper dependenceHigh (enhanced by CuSO₄)Contains copper but not as sensitive to supplementationIron-dependent, not copper
Typical pH optima6.5-7.04.0-6.05.0-7.0
Key inhibitorsKojic acid, tropoloneAzide, fluorideCyanide, azide
Oxygen requirementYesYesNo (uses H₂O₂)

What analytical techniques are most suitable for characterizing mepA-produced melanin?

Melanin produced by mepA can be characterized using multiple analytical approaches:

  • Spectroscopic methods: UV-visible spectroscopy can be used to analyze melanin's broad absorption spectrum. FTIR spectroscopy can identify functional groups present in the melanin polymer.

  • Chemical degradation: Alkaline hydrogen peroxide oxidation followed by HPLC analysis can provide information about the precursors and structure of the melanin polymer.

  • Physical characterization: Electron microscopy can reveal the morphology of melanin particles, while dynamic light scattering can determine particle size distribution.

  • Elemental analysis: Determining C, H, N content can provide insights into the composition and purity of the melanin.

  • Solubility tests: Analyzing solubility in various solvents (alkaline solutions, DMSO, etc.) can help distinguish between different types of melanin (eumelanin, pheomelanin, etc.).

These techniques together provide a comprehensive characterization of the melanin produced, allowing researchers to compare it with melanins from other sources or produced under different conditions.

What are the potential ecological roles of mepA-mediated melanin production in Rhizobium?

Several hypotheses about the ecological significance of melanin production in Rhizobium warrant further investigation:

  • UV protection: Melanin may protect Rhizobium cells from UV radiation in soil environments exposed to sunlight, enhancing survival in surface soil layers.

  • Oxidative stress resistance: Melanin's ability to scavenge free radicals may provide protection against oxidative stresses encountered in the rhizosphere or during plant infection.

  • Metal ion binding: Melanin has high affinity for metal ions, potentially conferring protection against heavy metal toxicity or serving as a metal ion reservoir.

  • Competitive advantage: Recent studies have shown that copper and melanin play a role in Myxococcus xanthus predation on Sinorhizobium meliloti, suggesting melanin might be involved in microbial interactions and competition .

  • Energy dissipation: Melanin can dissipate various forms of energy, potentially protecting the bacterium during environmental transitions.

Future studies using ecological approaches, competitive assays, and survival measurements under various stresses could help elucidate the true ecological significance of this plasmid-borne trait.

How might recombinant mepA be used in biotechnological applications?

Recombinant mepA from R. meliloti has several potential biotechnological applications:

  • Bioremediation: Tyrosinases can oxidize phenolic pollutants, suggesting potential applications in bioremediation of contaminated soils or waters.

  • Biosensors: Tyrosinases can be incorporated into electrochemical biosensors for detecting phenolic compounds in environmental samples or food products.

  • Cross-linking of proteins: Tyrosinase-mediated protein cross-linking can be used in food processing or biomaterial production.

  • Organic synthesis: Bacterial tyrosinases, including mepA, have applications in organic synthesis for producing complex phenolic compounds .

  • Melanin production: Recombinant systems for melanin production could be developed for various applications in materials science, cosmetics, and biomedical fields.

Future research could focus on optimizing expression systems, improving enzyme stability, and developing specific applications based on the unique properties of R. meliloti mepA.

What insights might comparative genomics of tyrosinase genes across Rhizobium species provide?

Expanding comparative genomics studies of tyrosinase genes across Rhizobium and related species could:

  • Trace evolutionary history: Determine whether tyrosinase genes evolved within Rhizobium or were acquired through horizontal gene transfer.

  • Identify structural variants: Compare enzyme structures to identify specialized adaptations in different species.

  • Map regulatory networks: Elucidate how different regulatory systems control tyrosinase expression across species.

  • Correlate with ecological niches: Determine whether tyrosinase variants correlate with specific host plants or soil environments.

  • Guide protein engineering: Identify natural variants with enhanced stability or catalytic properties that could guide protein engineering efforts.

The discovery that R. meliloti tyrosinase genes show strong hybridization within the species but not with other Rhizobium species suggests significant evolutionary divergence that warrants further investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.