Recombinant Rhizobium meliloti Uncharacterized protein in ackA 5'region

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its implementation.
Synonyms
Uncharacterized protein in ackA 5'region; ORFA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-733
Protein Length
full length protein
Species
Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)
Target Protein Sequence
MPEQSSIPTIPTLSDAYTYALDAWQRSILFLDVMRQRGAQYEEHTAQTAPNVLDYEAELV CDGRKLDRPVNYALVRIVPPAGAVIDPLKKPFVVVDPRAGHGPGIGGFKADSEIGVAIKA GHACYFIGFLPEPVPGQTIEDITRSEAIFLETVIARHPDADGKPCVIGNCQAGWAVMILA SLRPELFGPIIIAGAPLSYWAGIRGQYPMRYSGGLLGGSWLTALTGDLGAGIFDGAWLVQ NFENQNPANTLWTKQYNLYSKVDTEAGRYLGFERWWGGHVRLNAEEMQFIVDELFVGNKL AAGKIQTSDGTTIDMRNIRSPIVVFCSKGDNITPPAQALDWILDLHDSVDEIRAHGQTIV YTVHEKIGHLGIFVSAGVARKEHDEFASNIDLIDVLPPGLYEAVLEPVGPAVENPDLVSG EWIMRCEARTLDDIRAFGGNDLEDDRRFAAAARVSEINLALYRTYLQPWIKGMVTPPMAE AMRSMHPLRLQYEVFGPGNPVMAWVEAAAGLIRDARQPVAPDNPLLALQENMSRQVVDGL EAWRQMVEHLSEQKFREIYGAPALQAALGIDTQTDRPPRQAAKNCWHHALLENKIAALKA DMAKGGIREALARALLFVGMARGRVDERGFEAVRRLRRAHPSAKQLTLAEFKALMRTQYF MLLVDEEAALAAIPKLLPEKIEERGAAFAALREVLEAPGLLTGIAAERLQSVKALFGLSG EAPVPLMVRKVAR
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the Rhizobium meliloti Uncharacterized protein in ackA 5'region?

This protein (Q9X447) is a 733-amino acid protein located in the 5' region of the ackA gene in Rhizobium meliloti (also known as Sinorhizobium meliloti). It is typically produced as a recombinant protein with an N-terminal His-tag for research purposes. The protein's precise biological function remains undetermined, though its proximity to the ackA gene suggests potential involvement in acetate metabolism . Researchers studying this protein should begin with sequence analysis using tools like BLAST, Pfam, and SMART to identify conserved domains and potential functional similarities to characterized proteins in related species.

How does this protein potentially relate to the ackA pathway?

While the exact relationship remains uncharacterized, the protein's location in the 5' region of the ackA gene suggests a potential regulatory or functional relationship with acetate metabolism. The ackA gene encodes acetate kinase, which converts acetate to acetyl phosphate, a critical step in acetate utilization. Studies with E. coli have shown that mutations in the ackA-pta pathway significantly impact acetate production, lactate formation, and bacterial growth . To investigate this relationship in Rhizobium, researchers should consider:

  • Creating gene knockout mutants and analyzing metabolic changes

  • Performing qRT-PCR to examine co-expression patterns with ackA

  • Designing reporter assays to test potential regulatory functions

  • Conducting comparative metabolomic analyses between wild-type and mutant strains

These methodological approaches would provide insight into whether this protein functions as a regulator, co-factor, or has an independent metabolic role related to the ackA pathway.

What are optimal expression systems for this protein?

E. coli is the recommended expression host for this protein based on successful production reports . For optimal expression, researchers should implement the following methodology:

Expression ParameterRecommended ConditionRationale
E. coli strainBL21(DE3) or similarReduced protease activity, T7 RNA polymerase expression
Expression vectorpET series with T7 promoterStrong, inducible expression
Induction temperature18-25°CSlower expression may improve folding
IPTG concentration0.1-0.5 mMBalanced between yield and solubility
Expression time16-20 hoursMaximizes yield while minimizing degradation
Media supplements2% glucose, 0.2% lactoseMay enhance expression through catabolite repression

If solubility issues arise, researchers should consider fusion partners beyond the His-tag (e.g., MBP, SUMO) or codon optimization for Rhizobium-specific codons that may be rare in E. coli .

What purification strategies yield the highest purity?

Since the recombinant protein includes an N-terminal His-tag, immobilized metal affinity chromatography (IMAC) is the primary purification approach. A robust multi-step purification protocol should include:

  • Cell lysis: Sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF

  • IMAC using Ni-NTA resin with step gradients:

    • Binding: 20 mM imidazole

    • Washing: 50 mM imidazole

    • Elution: 250-300 mM imidazole

  • Size exclusion chromatography using Superdex 200 column

  • Analysis by SDS-PAGE to confirm >90% purity

This multi-step approach consistently yields protein with greater than 90% purity, essential for downstream functional and structural studies.

What storage conditions maintain optimal protein stability?

According to published protocols, researchers should follow these precise storage guidelines :

Storage ConditionRecommendationDuration
Long-term storage-80°CUp to 1 year
Medium-term storage-20°C2-3 months
Working aliquots4°CUp to 1 week
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0N/A
Additives5-50% glycerol (final concentration)Prevents freeze damage
Concentration0.1-1.0 mg/mL after reconstitutionPrevents aggregation

Researchers should avoid repeated freeze-thaw cycles, with aliquoting strongly recommended before freezing. For reconstitution, the lyophilized powder should be briefly centrifuged prior to opening, and reconstituted with deionized sterile water .

What experimental approaches can determine this protein's function?

A multi-faceted approach is required for comprehensive functional characterization:

  • Bioinformatic Analysis:

    • Sequence homology searches across related species

    • Domain prediction and structural modeling

    • Phylogenetic analysis to identify conserved regions

  • Genetic Approaches:

    • Gene knockout using CRISPR-Cas9 or homologous recombination

    • Complementation studies with mutated versions

    • Conditional expression systems to study dosage effects

  • Biochemical Characterization:

    • Activity assays with metabolites related to acetate metabolism

    • Protein-protein interaction studies using pull-down assays

    • Structural analysis through X-ray crystallography or cryo-EM

  • Systems Biology:

    • Transcriptomic analysis comparing wild-type and mutant strains

    • Metabolomic profiling under various growth conditions

    • Integration into metabolic models of Rhizobium

This systematic approach would allow researchers to move from correlation to causation in understanding the protein's function.

How might this protein interact with the ackA-pta pathway?

Based on research with similar metabolic systems, several interaction mechanisms are possible:

  • Regulatory Function: The protein might regulate ackA transcription or translation. Studies in E. coli show that mutations in the ackA-pta pathway significantly affect acetate production and bacterial growth patterns .

  • Metabolic Sensing: It may function as a metabolite sensor, responding to acetate or acetyl-phosphate levels. Researchers should design binding assays with radioactively labeled metabolites to test this hypothesis.

  • Structural Role: The protein could form complexes with enzymes in the pathway, enhancing their activity or specificity. Co-immunoprecipitation followed by mass spectrometry would help identify such interactions.

  • Alternative Pathway Component: It might catalyze a parallel or bypass reaction in acetate metabolism. Metabolic flux analysis comparing wild-type and knockout strains would reveal such alternative pathways.

In E. coli, ackA-pta pathway mutations led to reduced acetate and lactate production with increased pyruvate excretion (17.8 mM) under anaerobic conditions . Similar metabolic profiling in Rhizobium could reveal the specific effects of this uncharacterized protein.

How can researchers integrate this protein into systems biology studies?

Systems biology approaches should follow this methodological framework:

  • Network Integration:

    • Incorporate the protein into existing metabolic network models

    • Map potential interactions with transcriptional networks, especially considering that S. meliloti 1021 networks show complex hierarchical organization with eight regulatory levels

    • Use Cytoscape or similar software to visualize network connections

  • Multi-omics Integration:

    • Correlate protein expression with transcriptomic data across growth conditions

    • Perform metabolomic analysis focusing on acetate-related metabolites

    • Use proteomics to identify post-translational modifications

  • Flux Analysis:

    • Apply ^13C metabolic flux analysis to track carbon flow

    • Compare wild-type and mutant strains under various carbon sources

    • Model the effects of protein overexpression or deletion on metabolic flux

  • Comparative Systems Analysis:

    • Compare network positions across related rhizobial species

    • Identify conserved network motifs that include this protein

    • Assess evolutionary conservation of systems-level functions

The hierarchical transcriptional network organization in S. meliloti, with eight distinct regulatory levels and numerous transcription factors , provides a framework for positioning this protein within the broader cellular regulatory architecture.

What role might this protein play in Rhizobium-legume symbiosis?

While direct evidence linking this protein to symbiosis is lacking in the search results, researchers can explore this connection through:

  • Expression Analysis During Symbiotic Stages:

    • qRT-PCR analysis during different nodulation stages

    • Promoter-reporter fusions to track expression in planta

    • Comparative proteomics between free-living and symbiotic states

  • Mutant Phenotyping:

    • Assess nodulation efficiency, nodule number, and structure

    • Measure nitrogen fixation rates using acetylene reduction assays

    • Analyze bacteroid differentiation and persistence

  • Metabolic Contribution:

    • Investigate carbon metabolism changes during symbiosis

    • Assess the impact on dicarboxylic acid utilization, critical for bacteroid metabolism

    • Explore connections to the pSymB chromid, which has been shown to be a hot spot for positively selected genes in S. meliloti

The genomic context is particularly important since S. meliloti has a multipartite genome with replicon-specific behaviors related to strain differentiation . The pSymB chromid contains genes more widespread in distant taxa than those on other replicons, suggesting unique evolutionary pressures that may affect this protein's function in symbiosis.

How can researchers overcome solubility and stability issues?

Protein solubility and stability challenges can be addressed through systematic optimization:

ChallengeRecommended ApproachImplementation Details
Low solubility during expressionReduce expression temperatureExpress at 18°C for 24 hours
Add solubility enhancersInclude 0.1% Triton X-100 or 10% glycerol in lysis buffer
Test alternative fusion tagsMBP or SUMO tags often improve solubility
Protein precipitation after purificationOptimize buffer compositionTest different pH (7.0-8.5) and salt concentrations (100-500 mM NaCl)
Add stabilizing agentsInclude 5-10% glycerol, 1 mM DTT, or 0.05% CHAPS
Determine aggregation thresholdPerform concentration-dependent DLS analysis
Activity loss during storageAliquot before freezingPrepare single-use aliquots to avoid freeze-thaw cycles
Add protectantsInclude 10% trehalose or sucrose
Optimize protein concentrationMaintain 0.5-1 mg/ml for storage

Each optimization step should be validated with appropriate quality control measures, including dynamic light scattering (DLS) to monitor aggregation state and activity assays to confirm functional integrity .

What controls are essential for functional characterization experiments?

Robust experimental design requires these methodological controls:

  • Negative Controls:

    • Purified tag-only protein to account for tag artifacts

    • Heat-denatured protein to distinguish between specific and non-specific effects

    • Buffer-only treatments to establish baseline measurements

    • E. coli without the expression construct

  • Positive Controls:

    • Known acetate kinase (AckA) or phosphotransacetylase (Pta) proteins

    • Characterized proteins from related metabolic pathways

    • Commercially available enzymes with similar predicted functions

  • Validation Controls:

    • Multiple protein preparations to ensure batch consistency

    • Concentration gradients to establish dose-dependent effects

    • Time course experiments to capture dynamic responses

    • Different expression systems to rule out host-specific artifacts

These controls should be implemented systematically across all experimental platforms, including biochemical assays, interaction studies, and in vivo functional analyses.

How can structural biology illuminate this protein's function?

Structural determination provides foundational insights into function through:

  • X-ray Crystallography Approach:

    • Screen multiple crystallization conditions (sparse matrix approach)

    • Optimize promising conditions for diffraction-quality crystals

    • Consider selenomethionine labeling for phase determination

    • Analyze resulting structures for potential binding pockets and catalytic sites

  • Cryo-EM Analysis:

    • Particularly valuable if the protein forms larger complexes

    • Prepare negative-stained samples for initial characterization

    • Progress to vitrification for high-resolution structural analysis

    • Perform 3D particle reconstruction and classification

  • Computational Structure Prediction:

    • Utilize AlphaFold2 or RoseTTAFold for initial structural models

    • Validate predictions with limited experimental data (CD spectroscopy, SAXS)

    • Perform molecular dynamics simulations to identify flexible regions

    • Use structure-based virtual screening to identify potential binding partners

  • Structure-Function Analysis:

    • Design site-directed mutagenesis based on structural features

    • Create chimeric proteins to test domain functions

    • Perform structure-guided inhibitor design to validate active sites

    • Map evolutionary conservation onto structural models

The substantial size of this protein (733 amino acids) suggests it may contain multiple domains with distinct functions, making structural characterization particularly valuable for functional hypothesis generation.

How do mutations in this protein affect bacterial metabolism compared to ackA pathway mutations?

Research on ackA pathway mutations provides a comparative framework:

  • Metabolic Impact Comparison:

    • In E. coli, ackA-pta mutations significantly reduced acetate and lactate production

    • The ackA-pta and ldh double-mutant accumulated pyruvate (17.8 mM) under anaerobic conditions

    • Similar metabolic profiling should be performed with mutations in the uncharacterized protein

  • Growth Phenotype Analysis:

    • E. coli ackA-pta and ldh double-mutants showed 67% higher cell density in large-scale cultures

    • Comparable growth studies with the uncharacterized protein mutants would reveal functional relationships

  • Recombinant Protein Production Effects:

    • The ackA-pta and ldh double-mutant strain achieved 179% improvement in recombinant protein production

    • This suggests testing whether mutations in the uncharacterized protein similarly affect heterologous protein expression

  • Conditional Phenotypes:

    • Create systematic mutation series (point mutations, truncations, domain swaps)

    • Test growth under various carbon sources and oxygen conditions

    • Compare metabolic profiles using targeted and untargeted metabolomics

    • Assess changes in gene expression using RNA-seq

These comparative approaches would establish whether the uncharacterized protein functions within or parallel to the established ackA pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.