Recombinant Rhizobium meliloti Uncharacterized sensor-like histidine kinase R01002 (R01002)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
R01002; SMc00059; Uncharacterized sensor-like histidine kinase R01002
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
R01002
Target Protein Sequence
MAGRWTSLVDEAAAPWLPRGGLGSAIARHDFRRLRAVAAVSLTALPIVPLALTLALPVSA ALPAGAALWASASLLAAAAAIAGGREFPTDGEVEFAPAPELPDLNAAYDLFAGLVTVHDT RGHVLSVHGRDASEYLKLMRDPHGRGFIEQIHVSDRIAFLRAIDSLRLDSERSAVDIRLE RTSADGPQFAHIYCEMTPLRDAEGNLLAIVAQSRDVSEEARLQAEAAAKAAHAESANDAK TRFLAAVSHELRTPLNAILGFSDVLAGEYFGKLENDRQREYVSLIHQSGTHLLSVVNTML DMSKIEAGRYELLLEPFRVAEAIAACEAMLSHQAREKGVRLTSRVTRSVGEINADQRAFQ QILINLIGNAIKFTDRGGLVTVDAALEGNMLKLTVSDTGIGIAADKLQMLGQPFVQIQND YTRRYEGTGLGLSLVKGLAELHGGDVSIRSAEGEGTVIVVTIPSDASGAAERQCADAPVT VEFPPRLKQHADGKREAGVPALSEALHTGEIGREGGHGAAQAKTA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium meliloti Uncharacterized Sensor-Like Histidine Kinase R01002?

R01002 is a full-length (525 amino acids) uncharacterized sensor-like histidine kinase from Rhizobium meliloti (also known as Sinorhizobium meliloti). The recombinant protein (Q52969) is expressed in E. coli with an N-terminal His tag . Histidine kinases typically function as part of two-component regulatory systems in bacteria, where they sense environmental stimuli and initiate phosphorylation cascades that regulate cellular responses.

How does R01002 relate to other histidine kinases in Rhizobium/Sinorhizobium meliloti?

R01002 is one of several histidine kinases found in Rhizobium/Sinorhizobium meliloti. While not specifically characterized, it may belong to the HWE family of histidine kinases, as seen with RsiC (encoded by SMc01507), which regulates general stress response . The Sinorhizobium meliloti genome encodes multiple HWE-type histidine kinases (SMa0113, SMa1001, SMa1696, SMa2063, SMb20515, SMb20933, and SMc00322) , suggesting diverse signaling functions. R01002 may participate in environmental sensing, similar to other characterized kinases like ExoS, which regulates succinoglycan production .

What are optimal storage and reconstitution conditions for recombinant R01002?

Based on product specifications:

ParameterRecommended Condition
Storage temperatureStore at -20°C/-80°C upon receipt
AliquotingNecessary for multiple use
Freeze-thaw cyclesAvoid repeated freeze-thaw cycles
Working temperatureStore working aliquots at 4°C for up to one week
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Glycerol additionAdd 5-50% glycerol (final concentration) for long-term storage
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0

Prior to opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, aliquot for long-term storage to prevent protein degradation .

What experimental methods can effectively assess the kinase activity of R01002?

Autokinase activity can be measured using the following methodological approach:

  • γ32P-ATP assay: Mix R01002 protein (0.5-10 μM) with γ32P-ATP in reaction buffer (50 mM Tris pH 7.5, 200 mM KCl, 10 mM MgCl2) and incubate at room temperature. Separate proteins by SDS-PAGE and quantify phosphorylation by autoradiography or phosphorimaging .

  • Non-radioactive assay alternative:

    • Phos-tag SDS-PAGE to detect phosphorylated histidine

    • Anti-phosphohistidine antibodies for Western blot analysis

    • Coupled enzymatic assays monitoring ADP production

  • Experimental controls:

    • Include a negative control using a mutant with the conserved histidine replaced

    • Use a known active histidine kinase (such as VicK from S. mutans) as a positive control

How can researchers verify protein quality and integrity before kinase assays?

A multi-step verification protocol is recommended:

  • SDS-PAGE: Confirm >90% purity and expected molecular weight

  • Western blot: Verify presence of His-tag using anti-His antibodies

  • Size exclusion chromatography: Assess oligomerization state (typically dimeric for histidine kinases)

  • Multiangle Laser Light Scattering (MALS): Determine precise molecular mass, using equipment such as DAWN HELEOS II laser photometer, with analysis via ASTRA V software

  • Circular dichroism: Verify proper secondary structure folding

  • Dynamic light scattering: Check for protein aggregation

How might the structure of R01002 compare to characterized histidine kinases like RsiC or VicK?

While R01002's structure is uncharacterized, comparative analysis with VicK provides structural insights:

  • Domain organization: Histidine kinases like VicK feature a modular design with connected domains: HAMP (signal transducer), PAS (sensor), DHp, and CA (catalytic and ATP binding) . R01002 likely shares this general architecture.

  • Key structural features:

    • Dimeric structure with a central four-helix bundle (DHp domain)

    • Conserved histidine residue protruding from DHp helices for phosphorylation

    • CA domain with a mixed α/β sandwich fold structurally related to the GHKL ATPase family

    • Interdomain interface burying approximately 1250 Å2 from solvent exposure

  • Mechanistic implications: The VicK structure reveals asymmetric positioning of CA domains and different conformations within the DHp domain dimer, suggesting a sequential autokinase activation model . R01002 may operate through similar conformational changes.

What biological role might R01002 play in Rhizobium meliloti signaling networks?

Based on functional studies of other histidine kinases in Rhizobium/Sinorhizobium meliloti:

  • Potential stress response regulation: Similar to RsiC, R01002 could function as a bifunctional histidine kinase/phosphatase regulating stress responses through phosphorylation/dephosphorylation of a response regulator .

  • Symbiotic relationship roles: May participate in sensing plant-derived signals during root colonization, similar to systems described in S. meliloti that regulate the nitrogen-fixing symbiotic relationship with legume plants .

  • Nutrient acquisition: Could function in a two-component system similar to those involved in nutrient sensing, such as the biotin transport system in S. meliloti .

  • Succinoglycan production: Might regulate exopolysaccharide production, similar to the ExoS-ChvI two-component system that controls succinoglycan synthesis, which is essential for establishing plant-microbe symbiosis .

How can researchers identify potential cognate response regulators for R01002?

A systematic approach to identify cognate response regulators includes:

  • Genomic context analysis: Examine genes adjacent to R01002 for potential response regulators, as they are often encoded in the same operon .

  • Phosphotransfer profiling:

    • Express and purify candidate response regulators

    • Perform in vitro phosphotransfer assays using γ32P-ATP-labeled R01002

    • Analyze by SDS-PAGE and autoradiography to detect phosphorylated response regulators

  • Bacterial two-hybrid assays: Screen for protein-protein interactions between R01002 and candidate response regulators.

  • Co-immunoprecipitation: Use His-tagged R01002 to pull down interacting partners from cell lysates, followed by mass spectrometry identification.

  • Comparative genomics: Identify response regulators that co-evolved with R01002-like histidine kinases across related bacterial species.

What are common challenges when working with recombinant histidine kinases like R01002?

Researchers should anticipate and address these common challenges:

  • Autophosphorylation during expression: Histidine kinases may become active during expression, leading to heterogeneous phosphorylation states. Consider expressing catalytically inactive mutants or dephosphorylating the protein post-purification.

  • Phosphohistidine instability: The N-P bond in phosphohistidine is labile under acidic conditions. Maintain neutral to slightly basic pH (7.0-8.0) throughout purification and analysis.

  • Oligomerization issues: Histidine kinases typically function as dimers. Ensure buffer conditions support proper oligomerization by including appropriate salt concentrations (200-300 mM) and stabilizing agents.

  • Insolubility: The hydrophobic transmembrane regions may cause aggregation. Express only the cytoplasmic portion or use detergents for full-length protein.

  • ATP hydrolysis during storage: Include ATP analogs or remove Mg2+ to prevent unwanted catalytic activity during storage.

What kinase-dead mutants would be useful controls for R01002 functional studies?

Based on studies of other histidine kinases, the following mutants would serve as valuable controls:

  • Histidine mutant: Identify and mutate the conserved phosphoacceptor histidine to alanine (H→A), which should abolish autokinase activity.

  • ATP-binding site mutant: Mutate conserved residues in the ATP-binding pocket (G-box) to disrupt ATP binding.

  • Proline mutant: As seen with VicK, a conserved proline adjacent to the phosphoacceptor histidine contributes to helical bending essential for autokinase activity. Identify and mutate this proline to test its role in R01002 function .

  • DHp-CA interface mutants: Alter residues at the interdomain interface to disrupt conformational changes necessary for catalysis.

These mutants should be verified by the same autokinase assays used for wild-type R01002 to confirm loss of function.

How can researchers distinguish between kinase and phosphatase activities of R01002?

To differentiate between kinase and phosphatase activities:

  • Sequential assay approach:

    • First, measure autokinase activity using γ32P-ATP

    • Then, after removing ATP, monitor dephosphorylation of the phosphorylated protein over time

  • Phosphatase-specific conditions:

    • Test activity in the absence of ATP but presence of ADP, which often promotes phosphatase activity

    • Compare activities with different divalent cations (Mg2+ typically favors kinase activity, while Mn2+ may enhance phosphatase activity)

  • Domain-specific mutations:

    • Create mutations that specifically affect one activity but not the other

    • In HWE-family kinases like RsiC, specific residues have been identified that affect kinase or phosphatase activities differently

  • Phosphatase-specific inhibitors:

    • Use inhibitors like sodium orthovanadate to specifically block phosphatase activity

    • This can help isolate and quantify kinase activity independently

These approaches, used together, can provide a comprehensive assessment of R01002's bifunctional capabilities.

How might structural studies advance our understanding of R01002 function?

Structural studies could reveal critical insights through:

  • Full-length structure determination: Crystallography or cryo-electron microscopy of the complete R01002 protein would reveal domain arrangements and potential conformational changes during signaling, similar to the VicK structure .

  • Ligand-binding studies: Identifying small molecules or environmental signals that bind to R01002's sensing domain would clarify its activation mechanisms.

  • Comparative structural analysis: Mapping R01002 onto known structures of HWE-family histidine kinases like RsiC would highlight conserved and divergent features .

  • Dynamic structural studies: NMR or hydrogen-deuterium exchange mass spectrometry could capture conformational changes during the phosphorylation cycle.

What genomic and transcriptomic approaches could elucidate R01002's biological role?

A multi-omics strategy would provide comprehensive functional insights:

  • Transcriptome analysis: Compare gene expression profiles between wild-type and R01002 knockout strains under various environmental conditions.

  • ChIP-seq of response regulators: Identify genome-wide binding sites of putative response regulators that partner with R01002.

  • Phosphoproteomics: Analyze changes in the cellular phosphoproteome in response to R01002 activation or deletion.

  • Comparative genomics: Examine conservation and co-evolution patterns of R01002 and potential response regulators across Rhizobiales.

  • Genetic interaction mapping: Construct double mutants with other signaling proteins to identify functional relationships and redundancy.

How might synthetic biology approaches utilize R01002 for engineered signaling systems?

R01002 could be repurposed for synthetic biology applications:

  • Chimeric sensor design: Replace the sensing domain with alternative input domains to create novel environmental sensors.

  • Orthogonal signaling pathways: Engineer R01002 and cognate response regulators as insulated signaling modules in heterologous hosts.

  • Tunable gene expression systems: Couple R01002 signaling to synthetic promoters for controlled gene expression in response to specific inputs.

  • Biosensors: Develop whole-cell biosensors using R01002-based pathways linked to reporter genes for environmental monitoring.

  • Optogenetic control: Fuse light-sensitive domains to R01002 to enable optical control of histidine kinase activity and downstream signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.