Recombinant Rhizobium meliloti Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; upk; R00328; SMc00408; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
uppP
Target Protein Sequence
MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL VYFQKLLAIALALPTSVKARRFVFSVLLAFLPAALIGAAAHGFIKSVLFETPMLICVVLI VGGIILYAIDRLPLTPRYTDVFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTD KRSAAEFSFFLAMPTMVGAFALDLYKNRDALSFDDVGLIAAGFIAAFIAGIFVVRSLLDF VSHRGFTPFAIWRILVGTAGLVGLWLLG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase (EC 3.6.1.27), commonly known as uppP, is an integral membrane enzyme that plays a crucial role in bacterial cell wall synthesis. The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate, an essential step in peptidoglycan biosynthesis pathway . In Rhizobium meliloti (also known as Ensifer meliloti or Sinorhizobium meliloti), uppP functions as a key component in the recycling of lipid carriers, which are necessary for the translocation of cell wall precursors across the cytoplasmic membrane. This enzymatic activity is vital for maintaining bacterial cell wall integrity and providing resistance to certain antibiotics .

What are the molecular characteristics of recombinant R. meliloti uppP?

Recombinant Rhizobium meliloti uppP (Uniprot No. Q92SP2) is available as a partial recombinant protein with a purity of >85% as determined by SDS-PAGE analysis. The enzyme belongs to the class of hydrolases that act on acid anhydrides, specifically phosphorus-containing anhydrides. It is also known by alternative names including Bacitracin resistance protein and Undecaprenyl pyrophosphate phosphatase . When expressed recombinantly, the protein is typically produced in yeast expression systems to maintain proper folding and functionality of this membrane-associated enzyme .

What are the optimal conditions for expression and purification of recombinant R. meliloti uppP?

For successful expression and purification of functionally active recombinant R. meliloti uppP, a yeast expression system has been demonstrated to be effective . Unlike bacterial expression systems that might struggle with proper folding of membrane proteins, yeast provides appropriate post-translational modifications and membrane insertion machinery. The purification protocol typically involves:

  • Cell lysis under non-denaturing conditions

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography using an appropriate tag

  • Size exclusion chromatography for final purification

The purified protein should maintain >85% purity as assessed by SDS-PAGE analysis to ensure reliability in subsequent functional studies .

What are the recommended storage conditions for maintaining uppP stability and activity?

The stability and activity of recombinant R. meliloti uppP are highly dependent on proper storage conditions. Based on empirical data, the following guidelines are recommended:

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for cryoprotection

  • Aliquot the solution to avoid repeated freeze-thaw cycles

  • Store at -20°C/-80°C for long-term storage

  • Working aliquots may be kept at 4°C for up to one week

The shelf life varies by formulation: liquid preparations typically remain stable for 6 months at -20°C/-80°C, while lyophilized formulations maintain activity for up to 12 months under the same conditions .

What is known about the active site composition of uppP, and how does it compare between bacterial species?

The active site of bacterial uppP enzymes contains conserved motifs that are critical for catalytic activity. While detailed structural data specific to R. meliloti uppP is limited, comparative studies with E. coli UppP reveal that the active site likely comprises:

  • An (E/Q)XXXE motif involved in catalysis

  • A PGXSRSXXT motif contributing to substrate binding and specificity

  • A conserved histidine residue essential for function

E. coli UppP mutagenesis studies have identified several critical residues including E21, S26, S27, and R174, with S26 and S27 appearing to have partially redundant functions in catalysis . By sequence homology, similar residues would be expected to be important in R. meliloti uppP, though species-specific differences may exist that affect substrate specificity or catalytic efficiency.

How can researchers monitor uppP enzymatic activity in real-time?

Real-time monitoring of uppP activity can be accomplished through several methodologies, with mass spectrometry being particularly powerful. A protocol that has proven effective includes:

  • Preparation of enzyme-substrate mixtures in micellar solutions

  • Incubation under controlled temperature conditions

  • Quenching the reaction at specified time points by transitioning from micellar solution to gas phase

  • Mass spectrometric analysis to detect:

    • Substrate (undecaprenyl pyrophosphate) depletion

    • Product (undecaprenyl phosphate) formation

    • Enzyme-substrate and enzyme-product complexes

This approach allows researchers to observe the progression of the enzymatic reaction, including intermediate steps and binding events, providing insights into the catalytic mechanism.

What is the substrate specificity of uppP, and how is it determined experimentally?

UppP enzymes generally show preference for long-chain undecaprenyl pyrophosphate substrates. Experimental determination of R. meliloti uppP substrate specificity can be accomplished through competitive binding assays comparing binding affinities and processing rates of different substrates.

Research with E. coli UppP indicates that the enzyme binds more favorably to C55-PP (the "true" carrier lipid substrate) compared to shorter chain variants like C15-PP . This specificity can be quantified using biochemical assays that measure:

  • Binding affinity through equilibrium studies

  • Catalytic efficiency through kinetic measurements

  • Competitive inhibition patterns with structural analogs

For R. meliloti uppP, similar experimental approaches would be expected to reveal substrate preferences that align with its physiological role in peptidoglycan biosynthesis.

What is the role of divalent cations in uppP activity and how can this be exploited in experimental design?

UppP enzymes require divalent cations for optimal catalytic activity. This dependency provides useful experimental leverage for controlling enzyme activity in laboratory settings. Evidence from E. coli UppP studies shows that:

  • Addition of metal chelators like EDTA significantly reduces or eliminates UppP activity

  • The reaction can be slowed by reducing divalent cation concentration (e.g., using 20 μM EDTA) to capture intermediate steps

  • Complete inhibition occurs at higher EDTA concentrations (e.g., 200 μM)

These properties allow researchers to design time-course experiments where reaction rates can be precisely controlled through manipulation of available divalent cations. For R. meliloti uppP, similar cation dependencies would be expected, though the specific concentration requirements might differ.

Which amino acid residues are critical for uppP catalytic activity and how can site-directed mutagenesis be used to investigate them?

Based on studies with E. coli UppP, several critical residues have been identified that are likely conserved across bacterial species including R. meliloti:

MutationEffect on ActivityProposed Role in Catalysis
E21ALimited effect aloneActivates S27; E17 may compensate
S26ASeverely reduced activityPartial redundancy with S27
S27ASeverely reduced activityPrimary nucleophile for attack on phosphate
S26A/S27AComplete loss of activityElimination of redundant catalytic serines
R174AComplete loss of activityCritical for phosphoenzyme intermediate
S26A/R174AComplete loss of activityMultiple disruption of catalytic machinery

To investigate critical residues in R. meliloti uppP, a systematic site-directed mutagenesis approach is recommended:

  • Identify conserved residues through sequence alignment with characterized homologs

  • Generate single and double point mutations

  • Express and purify mutant proteins under identical conditions

  • Assess activity using real-time assays with natural substrates

  • Conduct complementation studies in uppP-deficient bacterial strains

How does the membrane environment affect uppP function and how can this be studied?

As an integral membrane protein, uppP function is influenced by its lipid environment. Experimental approaches to investigate this relationship include:

  • Reconstitution in liposomes with defined lipid compositions

  • Activity assays in the presence of specific phospholipids

  • Mass spectrometry studies of protein-lipid interactions

Research with E. coli UppP indicates that the enzyme's activity is affected by the presence of phospholipids such as POPE and POPG, which are abundant in bacterial membranes . Lipids may influence:

  • Protein stability and folding

  • Oligomerization state (e.g., lipid-mediated dimerization observed with E. coli UppP)

  • Substrate accessibility and binding orientation

  • Catalytic efficiency through allosteric effects

Similar influences would be expected for R. meliloti uppP, potentially with species-specific adaptations related to the native membrane composition of this organism.

How can uppP be exploited as a target for antimicrobial development?

UppP represents a promising target for novel antimicrobial compounds due to its essential role in cell wall synthesis. Research strategies for targeting R. meliloti uppP might include:

  • High-throughput screening of chemical libraries against purified recombinant enzyme

  • Structure-based drug design leveraging homology models or experimental structures

  • Fragment-based approaches to identify binding pockets beyond the active site

  • Development of mechanism-based inhibitors that mimic transition states

The bacitracin resistance function of uppP provides a natural proof-of-concept that inhibiting this enzyme can sensitize bacteria to certain antibiotics . Researchers should consider:

  • Designing combination therapies that pair uppP inhibitors with existing cell wall-targeting antibiotics

  • Exploiting species-specific differences in uppP structure for selective targeting

  • Investigating whether R. meliloti-specific uppP inhibitors could have applications in agricultural settings by affecting symbiotic relationships with host plants

What comparative approaches can reveal evolutionary adaptations in uppP across bacterial species?

Comparative studies between R. meliloti uppP and homologs from other bacterial species can reveal evolutionary adaptations related to ecological niches. Research methodologies might include:

  • Phylogenetic analysis of uppP sequences across diverse bacteria

  • Heterologous expression and functional comparison of uppP from different species

  • Chimeric protein construction to identify regions responsible for species-specific properties

  • Complementation assays in various bacterial backgrounds

E. coli studies suggest that different phosphatase families may have evolved to adapt to environments with varying availability of divalent cations . For R. meliloti, which exists both in soil and in symbiotic relationships with plant hosts, investigating whether its uppP shows specialized adaptations to these distinct environments could provide valuable insights into bacterial evolution and host-microbe interactions.

What are common pitfalls in uppP activity assays and how can they be addressed?

Researchers working with uppP frequently encounter several experimental challenges:

  • Low signal-to-noise ratio:

    • Solution: Increase enzyme purity (>85% by SDS-PAGE) and optimize substrate concentrations

    • Implement background subtraction using heat-inactivated enzyme controls

  • Inconsistent activity measurements:

    • Solution: Carefully control divalent cation concentrations

    • Standardize detergent types and concentrations in reaction buffers

    • Ensure consistent protein-to-lipid ratios in reconstituted systems

  • Substrate depletion during extended assays:

    • Solution: Implement real-time monitoring approaches

    • Design time-course experiments with appropriate sampling intervals

    • Consider slowing reaction rates using low EDTA concentrations (e.g., 20 μM)

  • Protein instability during purification:

    • Solution: Minimize freeze-thaw cycles

    • Store working aliquots at 4°C for maximum one week

    • Add glycerol (5-50%) for cryoprotection in long-term storage samples

How can researchers distinguish between direct and pleiotropic effects when studying uppP function in vivo?

When investigating uppP function in bacterial systems, distinguishing direct enzymatic effects from secondary consequences presents a significant challenge. Methodological approaches to address this include:

  • Controlled depletion systems:

    • Implement inducible expression systems to achieve short-term depletion

    • Monitor phenotypic changes temporally to separate primary from secondary effects

  • Complementation analysis:

    • Express catalytically inactive mutants in wild-type backgrounds to identify dominant-negative effects

    • Perform cross-species complementation to identify conserved functions

  • Targeted metabolite analysis:

    • Monitor levels of both direct substrates/products and downstream metabolites

    • Establish temporal relationships between metabolic changes to infer causality

  • Integrative omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Apply network analysis to distinguish direct regulatory connections from system-wide adaptations

Studies with other bacterial regulatory systems have demonstrated that long-term depletion can introduce confounding pleiotropic effects that may not reflect the primary function of the protein of interest .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.