Recombinant Rhizobium meliloti UPF0283 membrane protein R01807 (R01807)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
R01807; SMc00466; UPF0283 membrane protein R01807
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
R01807
Target Protein Sequence
MSDDFNDRRRRPAAFSVEAEEAIEREMEQTPRRAPGSFSEKVVMTPDAEDPFIGTTAAVE SLNLPEAMPRRRRLSFGKIAAGAFGILISLAVGLWIDRLVRDLFSRADWLGYGAVAVVAI GVIAFLIVVAREVFGMMQLTAVQTLKADLAAAAASGKTQAARAATARLVHLLAGNPRTAK GRARLAETEGDIIDAPHLIELTERELLAPLDREARRIILGAAKRVSIVTAVSPRALVDLG YVIYESARMIRAMAELYGGRPGTLGLLRLMRDVIAHLAVTGSIAVGDSLIQQILGHGLAS KLSARLGEGVINGLMTARIGIAAMDLCRPMPFRALKRPSIGDFLGDLAPGTARSEGSAG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are most effective for producing recombinant R01807?

    Recombinant R01807 is typically produced using E. coli expression systems . For optimal expression:

    • Vector selection: Vectors containing strong inducible promoters (T7, tac) are recommended for controlling expression.

    • Fusion tags: N-terminal 10xHis-tagging has been successfully employed to facilitate purification and detection .

    • Expression conditions: Lower temperatures (16-25°C) during induction can reduce inclusion body formation.

    • Alternative systems: Cell-free protein synthesis offers advantages for membrane proteins like R01807, allowing direct incorporation into nanodiscs or liposomes during synthesis .

    Expression SystemAdvantagesChallengesNotable Features
    E. coli (in vivo)High yield, cost-effectivePotential toxicity, inclusion bodiesWell-established protocols
    Cell-free (E. coli)Open system, rapid expressionHigher costCan incorporate nanodiscs during synthesis
    Cell-free (Sf21)Eukaryotic machinery, microsomes presentComplex preparationDirect incorporation into microsomes
  • What are the optimal storage and handling conditions for recombinant R01807?

    For maintaining stability and functionality of recombinant R01807:

    • Store at -20°C for regular storage, and at -20°C or -80°C for extended storage .

    • Avoid repeated freezing and thawing cycles which can lead to protein degradation.

    • Working aliquots can be stored at 4°C for up to one week .

    • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability .

    • The shelf life of liquid formulations is approximately 6 months at -20°C/-80°C, while lyophilized forms can maintain stability for up to 12 months .

  • How can researchers verify the quality and integrity of purified R01807?

    Multiple analytical techniques should be employed to assess R01807 quality:

    • SDS-PAGE: To verify molecular weight (~40 kDa) and purity (>85% is typically considered acceptable) .

    • Western blotting: Using anti-His antibodies to confirm the presence of the His-tagged protein.

    • Dynamic Light Scattering (DLS): To assess homogeneity and detect aggregation.

    • Nano Differential Scanning Fluorimetry (nDSF): To evaluate thermal stability and buffer optimization .

    • Size Exclusion Chromatography (SEC): To verify monodispersity and remove aggregates.

    • Mass Spectrometry: For accurate mass determination and verification of post-translational modifications.

Advanced Research Questions

  • What experimental approaches are most effective for studying R01807's membrane topology?

    Determining the membrane topology of R01807 requires multiple complementary approaches:

    a) Computational prediction: Programs like TMHMM, Phobius, and TOPCONS can predict transmembrane segments based on amino acid sequence.

    b) Accessibility mapping:

    • Cysteine scanning mutagenesis combined with thiol-reactive reagents

    • Protease protection assays using membrane vesicles

    • Antibody epitope mapping of regions facing different compartments

    c) Structural approaches:

    • Cryo-electron microscopy with the protein reconstituted in nanodiscs

    • NMR spectroscopy with isotopically labeled protein

    • X-ray crystallography (challenging but potentially high-resolution)

    d) Fluorescence techniques:

    • FRET measurements between strategically placed fluorophores

    • Site-specific labeling of accessible regions

    Current next-generation techniques for membrane protein study include copolymer-based approaches that maintain the protein in a lipid-rich environment, preserving its native structure for more accurate topology mapping .

  • How can R01807 be successfully reconstituted in membrane mimetic systems for functional studies?

    Successful reconstitution of R01807 for functional studies can be achieved through several approaches:

    a) Nanodisc reconstitution:

    • Mix purified R01807 (in detergent) with appropriate lipids and membrane scaffold proteins (MSPs)

    • Remove detergent via dialysis, biobeads, or gel filtration

    • Optimal lipid composition can be determined empirically, testing various lipid mixtures:

    ReactionLipid CompositionMSP ConcentrationNotes
    1DMPC (40μL)/DOTAP (10μL)50μL (200μM)Mixed charge environment
    2DMPC (25μL)/DOTAP (25μL)50μL (200μM)Higher positive charge
    3DOTAP (50μL)50μL (200μM)Positive charge only
    4DMPC (50μL)50μL (200μM)Neutral charge
    5DOPG (50μL)50μL (200μM)Negative charge only
    6DMPC (40μL)/DOPG (10μL)50μL (200μM)Mixed charge environment
    7DMPC (25μL)/DOPG (25μL)50μL (200μM)Higher negative charge

    b) Polymer-based systems:

    • Next-generation copolymers like UltrasoluteTM Amphipol 18 and Sulfo-Cubipol maintain a lipid-rich environment

    • These systems preserve the native state of membrane proteins better than detergents

    • Show improved stability in thermal shift assays compared to detergent systems

    c) Cell-free expression with direct incorporation:

    • As described in research, E. coli cell-free systems can co-translationally insert membrane proteins into nanodiscs :

    ComponentWith Nanodiscs (μL)Without Nanodiscs (μL)
    E. coli lysate17.517.5
    Reaction buffer20.020.0
    14C-Leucine1.251.25
    Plasmid (5nM)2.52.5
    Nanodiscs5.00.0
    Water3.758.75
    Total50.050.0
  • What methods can be used to study potential interactions between R01807 and other membrane proteins?

    Several complementary approaches can be employed to characterize R01807's protein-protein interactions:

    a) Affinity-based methods:

    • Pull-down assays using His-tagged R01807

    • Co-immunoprecipitation with specific antibodies

    • Affinity purification coupled with mass spectrometry (AP-MS)

    b) Proximity-based methods:

    • In vivo crosslinking followed by mass spectrometry identification

    • Proximity labeling approaches (BioID, APEX)

    • Förster Resonance Energy Transfer (FRET) between fluorescently labeled proteins

    c) Membrane Proteome Arrays:
    Similar to approaches used for antibody specificity testing, membrane proteome arrays containing thousands of proteins can be adapted to study R01807 interactions .

    d) Biophysical characterization:

    • Surface Plasmon Resonance (SPR) to measure binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) to detect interactions in solution

    e) Genetic approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Genetic suppressor screens to identify functional interactions

    • Synthetic genetic arrays to map genetic interactions

  • What role might R01807 play in Rhizobium meliloti's symbiotic relationship with host plants?

    While the exact function of R01807 in symbiosis is not explicitly characterized in the literature, several methodological approaches can help elucidate its potential role:

    a) Gene disruption studies:

    • Construction of deletion mutations using site-specific recombination systems like those described for S. meliloti

    • Testing mutant strains for nodulation ability, nitrogen fixation, and plant growth promotion

    • Complementation studies to confirm phenotype specificity

    b) Expression analysis:

    • RT-qPCR to measure R01807 expression during different stages of symbiosis

    • RNA-seq to identify co-regulated genes during nodule development

    • Promoter-reporter fusions to visualize expression patterns in planta

    c) Functional context:
    R. meliloti establishes symbiotic relationships with legumes like alfalfa, where biotin plays a key role in rhizosphere colonization . Investigating whether R01807 interacts with biotin metabolism pathways could be valuable, given that:

    • Biotin limitation affects R. meliloti growth in the rhizosphere

    • Recombinant strains with enhanced biotin synthesis show altered growth characteristics

    • R01807 might participate in biotin transport or signaling processes

    d) Comparative genomics:

    • Analysis of R01807 conservation across Rhizobium species with different host specificities

    • Assessment of gene neighborhood to identify functional associations

  • How can computational methods contribute to understanding R01807 function?

    Computational biology offers multiple approaches to gain insights into this uncharacterized membrane protein:

    a) Sequence-based analysis:

    • Multiple sequence alignments to identify conserved residues

    • Domain and motif prediction to recognize functional elements

    • Transmembrane topology prediction to map membrane-spanning regions

    b) Structure prediction:

    • Ab initio modeling using deep learning approaches (AlphaFold, RoseTTAFold)

    • Modeling R01807 within membrane environments using specialized tools

    • Molecular dynamics simulations to study conformational dynamics

    c) Function prediction:

    • Gene neighborhood analysis to identify functionally related genes

    • Co-expression network analysis across different conditions

    • Pathway mapping to situate R01807 in metabolic or signaling networks

    d) Design of soluble analogues:
    Recent research has demonstrated the computational design of soluble functional analogues of membrane proteins . This approach could:

    • Generate water-soluble versions of R01807 for easier structural studies

    • Maintain key functional regions while improving solubility

    • Facilitate biochemical and structural characterization

  • What are the most promising approaches for structural studies of R01807?

    Structural characterization of membrane proteins like R01807 presents unique challenges requiring specialized techniques:

    a) Cryo-electron microscopy (cryo-EM):

    • Most promising for full-length membrane proteins

    • Compatible with various membrane mimetics (nanodiscs, amphipols)

    • Can achieve near-atomic resolution for well-behaved samples

    • Examples from the literature show successful membrane protein structure determination in nanodiscs

    b) X-ray crystallography challenges and solutions:

    • Requires finding conditions for well-diffracting crystals

    • Lipidic cubic phase (LCP) crystallization often more successful than detergent-based methods

    • Crystallization chaperones (antibody fragments, nanobodies) can improve crystal quality

    • Surface engineering to reduce flexible regions may improve crystallization properties

    c) NMR spectroscopy approaches:

    • Solution NMR for specific domains or fragments of R01807

    • Solid-state NMR for the full-length protein in a membrane environment

    • Specialized labeling strategies to overcome size limitations:

      • Selective methyl labeling (ILV labeling)

      • Segmental isotopic labeling

      • Amino acid-specific labeling

    d) Hybrid methods:

    • Integrating low-resolution data (SAXS, cryo-EM) with computational modeling

    • Cross-linking mass spectrometry to provide distance constraints

    • Evolutionary covariance analysis to predict contact maps

  • What challenges exist in generating specific antibodies against R01807 and how can they be overcome?

    Generating high-quality antibodies against membrane proteins like R01807 presents several challenges:

    a) Challenges specific to membrane proteins:

    • Limited accessibility of epitopes in native conformation

    • Difficulties in maintaining proper folding during immunization

    • High conservation of membrane-spanning regions limiting immunogenicity

    b) Effective antigen preparation strategies:

    • Use of next-generation copolymers to stabilize R01807 in a native-like state

    • Design of peptide antigens corresponding to predicted extracellular loops

    • Production of soluble domain fragments for immunization

    c) Advanced antibody generation technologies:

    • Phage display with synthetic antibody libraries

    • Next-generation immunization strategies using DNA vaccines

    • Screening approaches using membrane protein arrays in native conformation

    d) Validation requirements:

    • Confirmation of specificity against recombinant and native R01807

    • Testing in multiple assay formats (Western blot, IP, flow cytometry)

    • Controls using deletion mutants or knockdown strains

    Research indicates that using copolymer-stabilized membrane proteins significantly improves antibody generation success compared to detergent-solubilized proteins, with >2x increased binding specificity observed in experimental studies .

  • How can genetic tools be optimized for studying R01807 function in Rhizobium meliloti?

    Genetic manipulation strategies specifically adapted for R. meliloti and similar bacteria include:

    a) Gene replacement and deletion systems:

    • Lambda integrase recombination systems adapted for R. meliloti

    • FRT/Flp recombinase system for creating precise deletions

    • CRISPR-Cas9 adaptation for Rhizobium species

    b) Expression control strategies:

    • Inducible promoter systems (nptII, tac) compatible with Rhizobium

    • Riboswitch-based expression control

    • Destabilization domains for post-translational control

    c) Reporter systems:

    • Fluorescent protein fusions for localization studies

    • Split reporter assays for protein-protein interaction analysis

    • Luciferase reporters for real-time expression monitoring

    d) Conjugation-based genetic manipulation:

    • Pentaparental mating procedures for shuttle vector transfer

    • R-prime plasmid systems for chromosome mobilization

    • oriT-containing vectors for efficient conjugal transfer

    These methods can be employed to create chromosomal tagging of R01807, controlled expression systems, and deletion mutants to systematically investigate its function in various conditions.

Research Applications and Future Directions

  • What are promising applications of studying R01807 for agricultural biotechnology?

    Understanding R01807 could have implications for agricultural applications through:

    a) Enhancement of symbiotic nitrogen fixation:

    • If R01807 plays a role in symbiosis, engineering improved variants could enhance nodulation efficiency

    • Optimization of R01807 expression could potentially increase nitrogen fixation rates

    • Understanding R01807 function might reveal new targets for improving plant-microbe interactions

    b) Biocontrol applications:

    • R. meliloti strains have been studied for biocontrol properties

    • Membrane proteins often mediate interactions with plant hosts and competing microorganisms

    • R01807 could potentially influence rhizosphere competence and plant growth promotion

    c) Bioremediation potential:

    • R. meliloti contains denitrification gene clusters

    • Membrane proteins like R01807 might participate in nitrogen cycling

    • Engineering strains with modified membrane protein expression could enhance bioremediation capabilities

  • How might comparative studies of R01807 across different Rhizobium species inform its function?

    Comparative analysis across rhizobial species can provide functional insights through:

    a) Evolutionary conservation patterns:

    • Identify highly conserved regions likely essential for function

    • Detect species-specific variations that might correlate with host specificity

    • Map conservation onto predicted structural features

    b) Gene neighborhood analysis:

    • Compare genomic context of R01807 homologs across species

    • Identify consistently co-located genes suggesting functional relationships

    • Detect operon structures that might indicate coordinated expression

    c) Host-specificity correlations:

    • Compare R01807 sequences from rhizobia with different host ranges

    • Identify variations that correlate with symbiotic properties

    • Test hybrid proteins to validate functional hypotheses

    d) Expression pattern comparisons:

    • Analyze transcriptomic data across species under similar conditions

    • Identify conserved regulatory patterns suggesting functional constraints

    • Correlate expression with symbiotic stages across different host-microbe pairs

  • What novel technologies might advance our understanding of R01807 in the coming years?

    Emerging technologies that could transform research on membrane proteins like R01807 include:

    a) Advanced structural biology methods:

    • Micro-electron diffraction (MicroED) for small crystals

    • Time-resolved cryo-EM for capturing dynamic states

    • Integrative structural biology combining multiple data types

    b) Single-molecule techniques:

    • Single-molecule FRET to study conformational dynamics

    • Atomic force microscopy for direct visualization in membranes

    • Nanopore recording for functional characterization

    c) Advanced computational approaches:

    • AI-driven structure prediction specific to membrane proteins

    • Molecular dynamics simulations with improved force fields

    • Systems biology models integrating membrane protein networks

    d) Next-generation protein engineering:

    • De novo design of soluble functional analogues

    • Computational redesign of membrane interfaces

    • Directed evolution in cell-free systems

    e) In situ techniques:

    • Cryo-electron tomography of R01807 in native membranes

    • Advanced imaging techniques for tracking proteins in live bacteria

    • Proximity labeling approaches for mapping interaction networks in vivo

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.