Recombinant Rhizobium meliloti UPF0700 transmembrane protein RA0705 (RA0705)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
RA0705; SMa1297; UPF0700 transmembrane protein RA0705
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Target Names
RA0705
Target Protein Sequence
MTVQRRRRIIKRRRSSVGLALVAAISFLAGMTDAIGLMSIGDFVSFMSGNTTRASVALVQ GDAAQGLLLIGGLVSFVLGNAAGVMISIRFRPQAALLFVSALLACAALQEGQPELRFVSL IFAMGAVNASVEQIEGLPVGLTYVTGALSRFGRGLGRWAMGVRNTQWIIQIVPWLGMFAG AIMGAVLVREAGDLALWVPSLAALLLTAAAFQIPRRWQSRFIQSR
Uniprot No.

Target Background

Database Links

KEGG: sme:SMa1297

Protein Families
UPF0700 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium meliloti UPF0700 transmembrane protein RA0705?

RA0705 is a transmembrane protein belonging to the UPF0700 family, expressed in Rhizobium meliloti (strain 1021), also known as Ensifer meliloti or Sinorhizobium meliloti . This protein consists of 225 amino acids spanning the full length of the protein, with multiple transmembrane domains that integrate into the bacterial membrane . RA0705 is encoded by the RA0705 locus, also referred to as SMa1297 in some genomic annotations . As a member of the uncharacterized protein family (UPF) 0700, its precise biological function remains to be fully elucidated, though structural features suggest involvement in membrane-associated processes.

The protein is characterized by its hydrophobic transmembrane domains that anchor it within the bacterial membrane, with regions extending into both the cytoplasmic and extracellular/periplasmic spaces. Its membrane topology and sequence conservation across related bacterial species suggest it may play a role in membrane organization, protein transport, or signal transduction processes that are critical for bacterial physiology.

How does RA0705 compare to other transmembrane proteins?

While RA0705 belongs to the UPF0700 family, it shares certain structural features with established transmembrane protein systems. By analyzing the search results and drawing parallels to better-characterized membrane proteins, we can make several observations:

Similar to components of the ER translocon complex described in eLife research, RA0705 may participate in protein-membrane interactions that facilitate proper protein integration into lipid bilayers . The multi-pass membrane topology of RA0705 resembles that of proteins involved in membrane protein biogenesis, such as TMCO1 and TMEM147, which form specialized channels or cavities within membranes .

The structural organization of RA0705, with its multiple transmembrane domains, shares characteristics with proteins like TMEM147 that form funnel-like structures extending through the membrane . These structural similarities suggest RA0705 might participate in processes involving the movement of proteins or specific substrates across or within the bacterial membrane.

What are the optimal storage conditions for recombinant RA0705?

Maintaining structural integrity and functional activity of recombinant RA0705 requires careful attention to storage conditions. Based on established protocols, the following guidelines are recommended:

For short-term storage (up to one week), maintain working aliquots at 4°C to minimize freeze-thaw cycles while retaining protein activity . For medium-term storage, keep the protein at -20°C in an appropriate buffer system, typically a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein's stability .

For long-term archival storage, maintain the protein at either -20°C or preferably -80°C to minimize degradation . It is critical to avoid repeated freeze-thaw cycles as these can significantly reduce protein activity and integrity. Therefore, preparing single-use aliquots prior to freezing is strongly recommended .

The storage buffer composition significantly impacts stability. The recommended formulation includes a Tris-based buffer system with 50% glycerol, which helps prevent ice crystal formation during freezing and provides stability to the protein's tertiary structure . This high glycerol concentration maintains a partially hydrated environment around the protein, preserving native conformation.

What expression systems and purification strategies are effective for RA0705?

Recombinant production of RA0705 presents unique challenges due to its multiple transmembrane domains. Based on available research:

E. coli expression systems have proven successful for RA0705 production, particularly for His-tagged versions of the protein . When expressing membrane proteins like RA0705, controlling induction conditions is critical—lower induction temperatures (16-25°C) and reduced inducer concentrations often yield better results by allowing proper membrane integration rather than inclusion body formation.

For purification, immobilized metal affinity chromatography (IMAC) using His-tag affinity is effective when the protein includes a histidine tag, as is available in commercial preparations . A two-phase extraction system may be beneficial during initial purification steps, using mild detergents to solubilize the protein from membranes while maintaining native structure.

The choice of detergent is crucial for maintaining RA0705 in a functionally relevant state. Detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin have proven effective for similar transmembrane proteins, though specific optimization for RA0705 may be required.

What analytical methods are most informative for RA0705 characterization?

Comprehensive characterization of RA0705 requires multiple complementary analytical approaches:

For structural characterization, circular dichroism (CD) spectroscopy provides valuable information about secondary structure content, particularly important for assessing the alpha-helical content expected in transmembrane domains. Thermal shift assays can determine protein stability under various buffer conditions, helping optimize formulations for functional studies.

Mass spectrometry approaches, particularly hydrogen-deuterium exchange mass spectrometry (HDX-MS), can provide insights into protein dynamics and solvent accessibility of different regions of RA0705. This technique is particularly valuable for membrane proteins where conventional structural biology techniques may be challenging.

For functional analysis, reconstitution into proteoliposomes or nanodiscs allows for membrane protein activity assays in a native-like environment. This approach may reveal transport or channel activities that are not detectable in detergent-solubilized preparations.

Given RA0705's potential involvement in protein-protein interactions, techniques such as cross-linking followed by mass spectrometry (XL-MS) or co-immunoprecipitation with candidate interacting partners can elucidate its functional relationships, similar to approaches used for characterizing the TMCO1 translocon complex .

How might RA0705 participate in membrane protein biogenesis?

RA0705's potential role in membrane protein biogenesis can be inferred by analyzing structural similarities with better-characterized systems:

The UPF0700 transmembrane protein family may function analogously to components of the ER translocon for multi-pass membrane protein biogenesis described in recent research . These translocon complexes form specialized channels or cavities within membranes that facilitate proper insertion and folding of transmembrane segments during protein synthesis.

The comparable structural features between RA0705 and components like TMCO1 or TMEM147 suggest it might participate in similar functions within bacterial membranes . The multiple transmembrane domains of RA0705 could form specialized lipid-filled cavities or channels that guide nascent membrane proteins into the lipid bilayer, similar to how the TMCO1 translocon creates a central membrane cavity .

Experimental approaches to test this hypothesis could include ribosome profiling and co-immunoprecipitation studies to identify mRNAs and nascent polypeptides associated with RA0705, similar to the RIP-seq approach used to characterize the TMCO1 translocon's substrate specificity . Crosslinking studies between RA0705 and translating ribosomes or nascent membrane proteins could provide direct evidence for this function.

What potential signaling functions might RA0705 perform?

The structural features of RA0705 suggest potential roles in transmembrane signaling processes:

The sequence motifs within RA0705, particularly the charged N-terminal region (RRRRIIKRRR), might function in signal recognition or transduction across the membrane . This charged cluster could interact with cytoplasmic signaling components or other membrane proteins to relay environmental information.

The hydrophobic transmembrane domains could form a channel or pore structure that regulates the passage of specific ions or small molecules, thereby contributing to cellular signaling cascades in response to environmental changes. The funnel-like arrangement of transmembrane helices seen in related proteins like TMEM147 supports this possibility .

To investigate these potential signaling functions, researchers might employ electrophysiology techniques to measure ion conductance, fluorescent reporter systems to track small molecule transport, or bacterial two-hybrid systems to identify interaction partners. Mutational analysis targeting the charged N-terminal region could determine its importance in potential signaling pathways.

What experimental approaches can resolve RA0705's membrane topology?

Determining the precise membrane topology of RA0705 is essential for understanding its function and requires specialized experimental approaches:

Cysteine scanning mutagenesis combined with accessibility studies can map which protein regions are exposed to different cellular compartments. This involves systematically replacing individual amino acids with cysteine residues and then probing their accessibility to membrane-impermeable sulfhydryl reagents from either side of the membrane.

Proteolytic digestion approaches using proteases with restricted accessibility (e.g., proteinase K acting only on the extracellular/periplasmic side) can identify protected versus exposed regions of the protein. Combined with Western blotting using domain-specific antibodies, this technique can build a comprehensive topology map.

GFP-fusion analysis at different positions within the protein sequence can determine which termini and loops are located in the cytoplasm (where GFP folds properly) versus the periplasm (where GFP typically fails to fold correctly).

Cryo-electron microscopy, ideally performed on RA0705 either alone or in complex with interaction partners, could provide direct structural evidence of its membrane orientation, similar to the approach used for the TMCO1 translocon complex . This technique may reveal key structural features such as funnel-like arrangements of transmembrane helices that suggest specific functional roles.

How can researchers address protein aggregation issues with RA0705?

Membrane proteins like RA0705 are prone to aggregation, which can compromise experimental results. Several strategies can mitigate this challenge:

Optimize detergent selection through systematic screening of different detergent types and concentrations. Mild detergents like DDM, LMNG, or GDN often provide a good balance between efficient solubilization and preserving native protein structure. Consider detergent mixtures or addition of cholesterol or specific lipids to better mimic the native membrane environment.

Implement temperature control strategies during purification and storage. Maintaining samples at 4°C during purification steps can reduce aggregation kinetics, while storage buffers containing glycerol (as recommended for RA0705, 50% glycerol) help maintain protein solubility during freeze-thaw cycles.

Consider alternative solubilization approaches such as amphipols, nanodiscs, or styrene-maleic acid copolymer lipid particles (SMALPs) that can encapsulate membrane proteins in more native-like environments compared to conventional detergents. These systems may better preserve RA0705's functional state by maintaining the surrounding lipid environment.

Implement rigorous quality control through analytical size exclusion chromatography, dynamic light scattering, or negative-stain electron microscopy to assess protein homogeneity before proceeding with detailed functional or structural studies.

How can conflicting functional data about RA0705 be reconciled?

When facing contradictory results about RA0705's function, researchers should implement a systematic analytical approach:

Evaluate experimental conditions carefully, as membrane protein function is highly dependent on lipid environment, detergent choice, pH, and ionic conditions. Systematic variation of these parameters may reveal condition-dependent functional states that explain apparent contradictions in the literature.

Consider protein tagging effects, as both N and C-terminal tags can influence membrane protein topology, oligomerization state, and function. Compare results obtained with differently tagged versions (His-tag, Flag-tag, etc.) and ideally validate with untagged protein where possible .

Implement parallel methodological approaches rather than relying on a single technique. For instance, if discrepancies exist between functional assays in detergent micelles versus proteoliposomes, consider additional reconstitution formats like nanodiscs or native membrane vesicles that may better preserve native function.

Verify protein identity and integrity in each experimental setup through mass spectrometry and Western blotting to confirm that proteolytic degradation or post-translational modifications are not causing functional variability between studies.

What emerging technologies could advance RA0705 characterization?

Several cutting-edge approaches show promise for deeper characterization of RA0705:

Cryo-electron tomography of bacterial membranes could visualize RA0705 in its native context, potentially revealing its organization and interactions with other membrane components. This technique has recently provided unprecedented insights into membrane protein organization within cellular environments.

Proximity labeling approaches such as APEX2 or BioID fused to RA0705 could map its protein interaction network in vivo, identifying potential functional partners and pathways. This would be particularly valuable for understanding RA0705's role in larger protein complexes or translocons.

Single-molecule tracking techniques using fluorescently labeled RA0705 could reveal its dynamic behavior within the bacterial membrane, including potential clustering, diffusion barriers, or association with specific membrane domains. These dynamics may provide functional insights not accessible through bulk biochemical approaches.

AlphaFold2 and other AI-based structural prediction tools have dramatically improved membrane protein modeling capabilities. Applied to RA0705 and potential interaction partners, these tools could generate testable structural hypotheses even in the absence of experimental structural data.

What unresolved questions about RA0705 warrant further investigation?

Several fundamental aspects of RA0705 biology remain to be explored:

The precise biological function of RA0705 remains undefined. Systematic phenotypic analysis of RA0705 knockout or depletion in Rhizobium meliloti under various environmental conditions could reveal its physiological importance. Complementation studies with mutated versions could then map structure-function relationships.

The potential involvement of RA0705 in multi-protein complexes similar to the TMCO1 translocon deserves investigation . Co-immunoprecipitation followed by mass spectrometry could identify stable interaction partners, while cross-linking approaches might capture more transient associations during active processes like membrane protein insertion.

The substrate specificity of RA0705, if it indeed functions in membrane protein biogenesis or transport, remains unknown. RIP-seq approaches similar to those used for the TMCO1 translocon could identify mRNAs whose translation products associate with RA0705, revealing potential substrates .

The evolutionary conservation and diversification of UPF0700 family proteins across different bacterial species may provide insights into RA0705's fundamental importance. Comparative genomic and phylogenetic analyses combined with heterologous expression studies could reveal how these proteins have adapted to specific bacterial physiologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.