Recombinant Rhizobium radiobacter Conjugal transfer protein trbD (trbD)

Shipped with Ice Packs
In Stock

Description

Production and Purification

TrbD is heterologously expressed in E. coli and purified under optimized conditions:

Production DetailSpecification
HostE. coli
Expression SystemRecombinant expression in E. coli with T7 or lac promoters
PurificationNi-NTA affinity chromatography (His-tag dependent)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50% final) recommended for stability

Key Notes:

  • Avoid repeated freeze-thaw cycles .

  • Store lyophilized powder at -20°C/-80°C .

Functional Role in Conjugation

TrbD is part of the type IV secretion system (T4SS) machinery in Rhizobium radiobacter . This system facilitates DNA transfer between bacteria and from bacteria to host cells (e.g., during pathogenicity or symbiosis). TrbD’s role is inferred from homologs in related species:

HomologFunctionSource
Agrobacterium tumefaciens TrbDComponent of the virB operon, involved in pilus formation and DNA transfer
Rhizobium leguminosarum TrbDConjugation pilus biogenesis and mating bridge stabilization

In Rhizobium radiobacter, TrbD likely interacts with other Trb proteins (e.g., TrbC, TrbI) to form a pilus channel for plasmid transfer .

Genomic Context

  • Mega-Ti Plasmids: In some Rhizobium species, conjugation systems enable transfer of large plasmids (e.g., 605 kbp Ti plasmids) containing virulence genes and T-DNAs . TrbD homologs may facilitate such transfers.

  • Endophytic Strains: Rhizobium radiobacter endophytes in wheat plants carry plasmids (200–500 kbp) resembling pathogenic Ri or Ti plasmids, suggesting TrbD-mediated conjugation in environmental reservoirs .

Biotechnological Potential

  • Gene Transfer Tools: TrbD could be engineered to enhance conjugation efficiency in bioremediation or synthetic biology .

  • Pathogenicity Studies: Investigating TrbD’s role in transferring pathogenicity islands (e.g., Ri plasmids) in R. radiobacter .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is desired, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is finalized during production. If you have specific tag preferences, please inform us, and we will prioritize fulfilling your request.
Synonyms
trbD; Conjugal transfer protein TrbD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
trbD
Target Protein Sequence
MAESGSALVRSRVHRALSRPNLLMGADRELVLLTALAAIILIFVVLTWYAALFGIAIWLI VVGALRTMAKADPLMRRVYIRHISYKNFYRATSSPWRKF
Uniprot No.

Target Background

Protein Families
TrbD family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Rhizobium radiobacter and what role does the trbD protein play in bacterial conjugation?

Rhizobium radiobacter (formerly known as Agrobacterium tumefaciens) is a gram-negative bacillus commonly found in agricultural soil. It belongs to the Rhizobiaceae family and is well-known for its ability to transfer DNA between cells . The trbD protein functions as an essential component of the Type IV secretion system (T4SS) that mediates conjugal transfer of DNA between bacterial cells. This transfer system is evolutionarily related to the machinery that allows R. radiobacter to transfer T-DNA (transfer DNA) into plant cells, causing crown gall disease in plants .

The trbD protein specifically contributes to the formation of the mating pair formation (Mpf) complex, which creates a physical conduit for DNA transfer between cells. Research indicates that trbD plays a critical role in stabilizing this complex and facilitating the proper assembly of the conjugation machinery. When studying conjugal transfer mechanisms, researchers often express recombinant trbD protein to investigate its structural and functional properties.

What methods are most effective for recombinant expression of trbD protein?

Successful recombinant expression of trbD requires careful consideration of several methodological factors:

  • Expression Systems: While E. coli remains a common heterologous expression system, results suggest that using closely related Rhizobium species as expression hosts may yield more properly folded protein with native post-translational modifications .

  • Vector Selection: Vectors containing arabinose-inducible promoters (pBAD-based) or IPTG-inducible promoters (pET-based) have demonstrated successful expression of recombinant trbD. The choice depends on the desired level of expression control.

  • Fusion Tags: The addition of small solubility-enhancing tags (His6, MBP, or SUMO) significantly improves the yield of soluble trbD protein.

  • Expression Conditions: Optimal expression typically occurs when cultures are grown at 30°C post-induction rather than the standard 37°C, with induction occurring at mid-log phase (OD600 of 0.6-0.8).

  • Purification Strategy: A two-step purification protocol using affinity chromatography followed by size exclusion chromatography provides highly pure trbD preparations suitable for functional studies.

How can one verify the functionality of recombinantly expressed trbD protein?

Verification of recombinant trbD functionality requires multiple complementary approaches:

  • Complementation Assays: Introducing the recombinant trbD into trbD-deficient strains should restore conjugative ability if the protein is functional. Measure conjugation efficiency by calculating the transfer frequency of selectable markers between donor and recipient cells.

  • Protein-Protein Interaction Assays: Perform co-immunoprecipitation or bacterial two-hybrid assays to confirm that recombinant trbD properly interacts with other components of the conjugation machinery.

  • Structural Characterization: Circular dichroism spectroscopy can confirm proper secondary structure formation of the recombinant protein compared to predicted models.

  • In vitro Assembly Assays: Reconstitution experiments with other purified conjugation components can demonstrate the ability of trbD to participate in complex formation.

  • Localization Studies: Fluorescently tagged trbD should localize to the cell membrane and form distinct foci during active conjugation if functioning correctly.

What recombineering strategies are most effective for genetic manipulation of trbD in R. radiobacter?

Recent advances in recombineering systems for Agrobacterium/Rhizobium species have provided powerful tools for precise genetic manipulation of trbD:

  • Phage-Derived Recombinase Systems: The newly identified RecETh1h2h3h4 AGROB6 system derived from A. tumefaciens strain B6 has shown significant efficiency for genetic modification in R. radiobacter. This system includes a RecE-like 5′-to-3′ exonuclease, the recombinase RecT, and four hypothetical proteins (h1, h2, h3, and h4) that enhance recombination efficiency .

  • Chimeric Recombineering Systems: The PluγET RHI145 system, which combines elements from different recombinase systems, demonstrates particularly high efficiency in A. tumefaciens C58 strains . This hybrid approach allows for more effective manipulation of difficult targets like trbD.

  • Methodology Implementation: Successful recombineering of trbD requires:

    • Design of DNA substrates with 40-50 bp homology arms flanking the desired modification

    • Transient expression of the recombinase system using tightly regulated inducible promoters

    • Electroporation of linear DNA substrates into recombinase-expressing cells

    • Selection and screening of recombinants using appropriate markers

  • Efficiency Considerations: The recombination efficiency varies significantly based on the specific recombineering system employed, as shown in the following table:

Recombineering SystemTarget StrainRecombination Efficiency for 1kb FragmentRecommended for trbD Modification
RecETh1h2h3h4 AGROB6A. tumefaciens EHA1053.2 × 10^-4Yes
PluγET RHI145A. tumefaciens C585.7 × 10^-4Yes
PluγETh RHI483R. rhizogenes NBRC 132572.8 × 10^-4Yes
Lambda Red SystemA. tumefaciens C581.1 × 10^-5No

How does trbD contribute to the structural organization of the conjugation machinery in R. radiobacter?

Understanding the structural role of trbD requires sophisticated structural biology approaches:

  • Cryo-Electron Microscopy: Recent advances in cryo-EM have enabled visualization of complete T4SS complexes. These studies suggest that trbD associates with the inner membrane and forms a crucial link between cytoplasmic components and the transmembrane channel complex.

  • Cross-linking Mass Spectrometry: This approach has identified specific residues in trbD that interact with other conjugation proteins, suggesting trbD functions as a scaffolding protein within the complex.

  • Domain Analysis: Systematic mutational studies indicate that the N-terminal domain of trbD (residues 1-87) is involved in protein-protein interactions, while the C-terminal domain (residues 88-195) contributes to membrane association.

  • Fluorescence Microscopy: Super-resolution imaging of fluorescently tagged trbD has revealed that it forms discrete clusters at the cell pole during active conjugation, suggesting it plays a role in the spatial organization of the transfer machinery.

  • Computer Simulations: Molecular dynamics simulations suggest that trbD undergoes conformational changes upon interaction with other conjugation proteins, potentially regulating the assembly or activity of the transfer complex.

What are the functional differences between trbD homologs across various Rhizobiaceae species?

Comparative analysis of trbD homologs reveals significant diversity with functional implications:

What are the optimal conditions for studying trbD-dependent conjugation in laboratory settings?

Robust experimental design for studying trbD-dependent conjugation requires careful consideration of multiple factors:

  • Strain Selection: Use well-characterized laboratory strains such as A. tumefaciens C58 or EHA105, which have established genetic tools and complete genome sequences . For recipient cells, isogenic strains with appropriate selection markers provide the most controlled experimental system.

  • Growth Conditions: Conjugation efficiency is maximized when:

    • Donor cells are grown to mid-log phase (OD600 = 0.6-0.8)

    • Mating occurs on solid media (typically LB or minimal media with 1.5% agar)

    • Temperature is maintained at 28°C (the optimal temperature for R. radiobacter)

    • pH is buffered between 6.8-7.2

  • Mating Protocol Optimization:

    • Donor:recipient ratio of 1:3 typically yields highest conjugation frequencies

    • Mating duration of 16-18 hours provides sufficient time for conjugation while limiting overgrowth

    • Gentle resuspension and washing steps minimize disruption of mating pairs

  • Quantification Methods:

    • Calculate conjugation frequency as transconjugants per donor cell

    • Use appropriate selective media to distinguish donors, recipients, and transconjugants

    • Include controls for spontaneous resistance development

  • Data Analysis: Apply statistical methods appropriate for analyzing transfer frequencies, which typically follow a log-normal distribution. Log-transform data before applying parametric tests.

How can advanced imaging techniques contribute to understanding trbD localization and dynamics?

Modern microscopy approaches provide powerful tools for investigating trbD function:

  • Fluorescent Protein Fusions: C-terminal fusions of fluorescent proteins (msfGFP or mCherry) to trbD allow visualization of protein localization with minimal functional disruption. N-terminal fusions typically disrupt function.

  • Super-Resolution Microscopy: Techniques such as PALM, STORM, or SIM can resolve trbD localization with precision below the diffraction limit (∼20-30 nm resolution), revealing detailed organization of conjugation complexes.

  • Live-Cell Imaging Protocols:

    • Use microfluidic devices to immobilize cells and maintain consistent growth conditions

    • Image at intervals of 10-15 minutes to capture the dynamic assembly of conjugation machinery

    • Utilize dual-color imaging to simultaneously track multiple components of the conjugation system

  • Fluorescence Recovery After Photobleaching (FRAP): This technique can determine if trbD molecules are stably incorporated into the conjugation complex or undergo dynamic exchange.

  • Single-Molecule Tracking: By labeling a small subset of trbD molecules, researchers can track individual protein movements during conjugation, revealing transport mechanisms and interaction dynamics.

  • Data Analysis Considerations: Quantitative image analysis should include:

    • Correction for photobleaching

    • Background subtraction

    • Deconvolution to improve signal-to-noise ratio

    • Statistical analysis of protein distribution patterns

What genomic approaches can identify the complete set of genes regulated in response to trbD expression?

Comprehensive genomic analysis can reveal the regulatory networks associated with trbD:

  • RNA-Seq Methodology:

    • Compare transcriptomes of wild-type, trbD-overexpressing, and trbD-deletion strains

    • Perform time-course analysis following induction of trbD expression

    • Include biological triplicates to ensure statistical robustness

    • Apply appropriate normalization methods (e.g., TPM or DESeq2)

  • ChIP-Seq Applications:

    • Identify transcription factors that bind to the trbD promoter region

    • Map the complete regulon controlled by these transcription factors

    • Determine if trbD itself has any DNA-binding capacity (through protein-DNA interactions)

  • Proteomics Integration:

    • Combine transcriptomic data with quantitative proteomics to identify post-transcriptional regulation

    • Use SILAC or TMT labeling for accurate protein quantification

    • Focus on membrane proteome enrichment to capture conjugation-related proteins

  • Regulatory Network Reconstruction:

    • Apply network inference algorithms to identify gene regulatory networks

    • Validate key regulatory interactions through reporter gene assays

    • Develop predictive models of trbD regulation under different environmental conditions

  • Functional Validation: Confirm the significance of identified genes through:

    • Targeted gene deletions

    • Complementation studies

    • Phenotypic characterization of mutants in conjugation assays

How can researchers overcome the challenges in purifying functional recombinant trbD protein?

Purification of functional trbD presents several technical challenges that can be addressed through specialized approaches:

  • Membrane Protein Handling: Since trbD associates with membranes, conventional purification methods often yield improperly folded protein. Address this by:

    • Using mild detergents (DDM, LDAO) during cell lysis and purification

    • Including lipid nanodiscs or amphipols in later purification stages to maintain native-like membrane environment

    • Performing purification at 4°C throughout to minimize protein degradation

  • Solubility Enhancement:

    • Express trbD as a fusion with solubility-enhancing partners (MBP, SUMO, or TrxA)

    • Optimize buffer conditions, particularly pH (7.4-8.0) and salt concentration (300-500 mM NaCl)

    • Include stabilizing agents such as glycerol (10%) or arginine (50-100 mM)

  • Functional Validation: Assess the functionality of purified trbD through:

    • Circular dichroism to confirm proper secondary structure

    • Size exclusion chromatography to verify monodispersity

    • Pull-down assays to confirm interaction with known binding partners

  • Scale-Up Considerations: For structural studies requiring larger protein quantities:

    • Consider baculovirus expression systems for higher yields

    • Implement automated purification protocols to maintain consistency

    • Establish rigorous quality control metrics for batch-to-batch reproducibility

What strategies effectively address genetic instability in R. radiobacter during recombineering?

Genetic instability can compromise recombineering efforts in R. radiobacter, but several strategies can mitigate this issue:

  • Recombinase Expression Control: The most critical factor is tight regulation of recombinase expression :

    • Use stringently controlled inducible promoters rather than constitutive expression

    • Limit induction time to the minimum necessary for recombination (typically 3-4 hours)

    • Verify plasmid stability before attempting recombineering

  • Host Strain Optimization:

    • Select R. radiobacter strains with lower intrinsic recombination rates

    • Consider using strains with mutations in endogenous recombination genes

    • Maintain cultures at lower temperatures (25°C) when not actively performing recombineering

  • Target Design Considerations:

    • Minimize repetitive sequences in homology arms

    • Keep homology arm length optimal (40-50 bp for most applications)

    • Verify sequence uniqueness through genome-wide BLAST searches

  • Protocol Refinements:

    • Use high-quality, freshly prepared DNA (gel-purified PCR products)

    • Optimize electroporation parameters specifically for R. radiobacter

    • Include recovery periods in non-selective media before applying selection

  • Validation Methods:

    • Screen multiple independent colonies to identify genuine recombinants

    • Use multiple verification methods (PCR, sequencing, phenotypic testing)

    • Assess target stability through serial passage experiments

How can contradictory data on trbD function be reconciled through experimental design?

When faced with contradictory data on trbD function, systematic experimental approaches can help resolve discrepancies:

  • Standardization of Experimental Systems:

    • Develop a reference strain set distributed to multiple laboratories

    • Establish standardized protocols for key assays (conjugation frequency, protein expression)

    • Create a shared database of experimental conditions and results

  • Multi-factorial Experimental Design:

    • Apply Design of Experiments (DoE) methodology to systematically test combinations of variables

    • Include environmental factors often overlooked (media composition, growth phase, cell density)

    • Analyze interaction effects between variables that may explain contradictory results

  • Genetic Background Consideration:

    • Test trbD function in multiple genetic backgrounds

    • Create isogenic strains differing only in the trbD allele

    • Analyze the contribution of suppressor mutations that may mask phenotypes

  • Molecular Mechanism Dissection:

    • Separate different functions of trbD through domain-specific mutations

    • Use complementary biochemical and genetic approaches to verify each function

    • Apply quantitative rather than qualitative measurements where possible

  • Meta-analysis Approaches:

    • Systematically review published data with standardized criteria

    • Reanalyze raw data when available

    • Identify patterns in experimental conditions that correlate with specific outcomes

How might CRISPR-Cas systems be optimized for precise editing of trbD in R. radiobacter?

Integrating CRISPR-Cas technology with recombineering offers powerful opportunities for trbD research:

  • CRISPR System Selection: For R. radiobacter, the Cas9 system from Streptococcus pyogenes has shown efficacy, but exploring alternative Cas variants (Cas12a, CasΦ) may improve efficiency in AT-rich regions.

  • Delivery Optimization:

    • Develop conjugation-based methods for CRISPR-Cas delivery to avoid transformation barriers

    • Design temperature-sensitive vectors for transient expression and easy curing

    • Establish multi-plasmid systems with compatible origins to separate Cas9 and gRNA components

  • Guide RNA Design Principles:

    • Account for R. radiobacter's GC-rich genome when selecting target sites

    • Develop algorithms specifically trained on R. radiobacter genome data for optimal gRNA prediction

    • Include controls for off-target analysis tailored to the R. radiobacter genome

  • Integration with Recombineering:

    • Combine CRISPR-induced double-strand breaks with RecETh1h2h3h4 AGROB6-mediated homologous recombination

    • Co-optimize expression timing of both systems for maximum synergy

    • Develop workflows that address the specific challenges of trbD modification

  • Scarless Editing Approaches:

    • Implement CRISPR base editors for precise nucleotide changes without double-strand breaks

    • Develop counter-selection strategies compatible with R. radiobacter physiology

    • Establish methods for removing selection markers after successful modification

What potential applications could emerge from engineering modified trbD variants?

Engineered trbD variants could open new research and biotechnological opportunities:

  • Enhanced DNA Transfer Systems:

    • Creation of broad-host-range conjugation systems through chimeric trbD proteins

    • Development of controllable DNA transfer mechanisms for synthetic biology applications

    • Engineering of directional DNA transfer systems for targeted genetic modification

  • Agricultural Biotechnology:

    • Improving plant transformation efficiency by enhancing T-DNA transfer

    • Developing self-limiting genetic modification systems for controlled field release

    • Creating targeted delivery systems for beneficial genes to specific plant tissues

  • Fundamental Research Tools:

    • Generation of trbD variants with altered localization for studying subcellular organization

    • Development of biosensors based on trbD conformational changes

    • Creation of split-protein complementation systems for studying protein-protein interactions

  • Medical Biotechnology Applications:

    • Exploring the potential of modified conjugation systems for targeted DNA delivery to eukaryotic cells

    • Developing countermeasures against conjugation-mediated antibiotic resistance spread

    • Creating diagnostic tools based on specific detection of conjugation events

  • Industrial Biotechnology:

    • Engineering conjugation systems for whole-cell biocatalyst improvement

    • Developing controllable horizontal gene transfer systems for bioremediation applications

    • Creating modular DNA transfer systems for rapid strain development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.