Recombinant Rhizobium radiobacter Conjugal transfer protein trbF (trbF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Rhizobium radiobacter Conjugal Transfer Protein TrbF (trbF) is a recombinant protein derived from Rhizobium radiobacter, a Gram-negative bacterium historically linked to Crown Gall disease in plants. TrbF is a component of the bacterial conjugation machinery, enabling horizontal gene transfer between cells. The recombinant form is engineered for research purposes, typically expressed in E. coli with a His-tag for purification. This protein is critical for studying bacterial conjugation mechanisms, genetic engineering applications, and symbiotic interactions .

Protein Characteristics

The recombinant trbF protein is characterized by the following properties:

ParameterSpecification
SourceRhizobium radiobacter (UniProt ID: P54914)
Expression HostE. coli
TagN-terminal His-tag
LengthFull-length (1–220 amino acids)
Purity>90% (SDS-PAGE validated)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional glycerol (5–50%)
Storage Conditions-20°C/-80°C (long-term), 4°C (working aliquots, ≤1 week)

Source: Creative BioMart

Functional Role in Bacterial Conjugation

TrbF belongs to the trb operon, a key component of the conjugative transfer system in Rhizobium and related species. This system facilitates plasmid transfer between bacterial cells, enabling the spread of genetic material such as tumor-inducing (Ti) plasmids in R. radiobacter .

Mechanism of Action

  1. Mating Pair Formation (Mpf): TrbF is part of the type IV secretion system (T4SS) responsible for establishing direct cell-cell contact during conjugation. This process involves membrane bridging and pilus formation .

  2. Quorum Sensing Regulation: The trb operon is regulated by quorum-sensing systems (e.g., TraR and acyl-homoserine lactones), which activate conjugation in response to environmental signals like opines produced by infected plants .

  3. Plasmid Transfer: TrbF interacts with other trb proteins (e.g., TrbB, TrbH) to form a channel for DNA transfer, enabling the transfer of plasmids such as Ti plasmids, which carry T-DNA for integration into host genomes .

Genetic Engineering

  • Agrobacterium-Mediated Transformation: TrbF’s role in conjugation mirrors mechanisms used in plant genetic engineering, where Agrobacterium transfers T-DNA into plant cells. Studying trbF aids in optimizing transformation efficiency and expanding host ranges .

  • Biocontrol Agents: Recombinant trbF variants could be engineered to disrupt pathogenic conjugation, reducing the spread of disease-causing plasmids in agricultural settings .

Symbiotic Interactions

  • Endofungal Symbiosis: R. radiobacter resides within the fungus Piriformospora indica, enhancing plant growth and disease resistance. TrbF may mediate bacterial-fungal interactions, though its exact role remains under investigation .

Pathogenicity Studies

  • Crown Gall Disease: TrbF’s involvement in plasmid transfer highlights its role in spreading Ti plasmids, which induce plant tumors. Understanding trbF could inform strategies to combat R. radiobacter infections in crops like blueberries and walnuts .

Expression and Purification

  • Host System: E. coli is preferred due to high yield and compatibility with His-tag purification .

  • Purity Assurance: SDS-PAGE confirms >90% purity, with contaminants potentially including E. coli chaperones or truncated trbF .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
trbF; Conjugal transfer protein TrbF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
trbF
Target Protein Sequence
MAGTTPPDNPYIAARNEWNERYGSYVKAAAAWRIVGITGMTMAVIGFGYALYQSTQVKLI PYIVEVDKLGTAVNAGFPQQIEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYGL LRTSDPATEKVNAWFRSNSPFEKAKTATVAIEVNNIVALSNQSYQVDWTEFERDRRGKET ATRRFRGIATVTLTPPQDEGVIRLNPIGLYLRDFDWTAQL
Uniprot No.

Target Background

Protein Families
TrbF family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the Rhizobium radiobacter Conjugal transfer protein trbF and what is its role in bacterial conjugation?

Conjugal transfer protein trbF is a critical component of the machinery responsible for forming mating bridges across which DNA is transferred during bacterial conjugation. The protein is encoded within the polycistronic trb operon, which contains 12 open reading frames (trbA-trbL) essential for conjugative transfer . Specifically, trbF has been identified as one of several genes (including trbB, trbC, trbD, trbE, trbF, trbG, trbI, trbH, and trbL) that are essential for transfer between bacterial strains .

The trbF protein is extremely hydrophobic, potentially possessing signal sequences for protein export and membrane-spanning domains, suggesting its involvement in the assembly of the mating pair apparatus that facilitates DNA transfer between cells . This protein functions within a complex system that enables the horizontal transfer of genetic material, including plasmids and other mobile elements, which can confer advantageous traits such as antibiotic resistance.

What are the optimal conditions for storage and handling of recombinant trbF protein?

For optimal preservation of structure and function, recombinant trbF protein should be stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein . Long-term storage should be maintained at -20°C, while extended storage should be at -20°C or -80°C to prevent degradation .

Researchers should be aware that repeated freezing and thawing cycles can significantly impact protein integrity and function. To mitigate this risk, it's advisable to prepare working aliquots that can be stored at 4°C for up to one week, minimizing the need for repeated freeze-thaw cycles . When designing experiments, researchers should account for these storage conditions to ensure consistent protein activity across studies.

What experimental approaches are most effective for studying trbF interactions within the conjugative transfer system?

Given that trbF functions as part of a complex system involving multiple protein-protein interactions, several methodological approaches can be employed:

  • Protein-protein interaction assays: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or pull-down assays can help identify direct interactions between trbF and other components of the Trb operon.

  • Site-directed mutagenesis: Creating specific mutations in hydrophobic regions or potential binding domains can help elucidate which amino acid residues are essential for trbF function and interaction with other proteins.

  • Fluorescence microscopy: Using fluorescently tagged trbF can help visualize its localization during the conjugation process, providing insights into its temporal and spatial dynamics.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify proximity relationships between trbF and other proteins in the conjugation apparatus.

These methodologies should be designed with consideration of trbF's hydrophobic nature, which may present challenges for standard protein interaction assays typically optimized for soluble proteins .

How does trbF compare to analogous proteins in other conjugative systems?

The trbF protein belongs to a family of conjugative transfer proteins that are remarkably conserved across different bacterial species. Comparative analysis reveals significant similarities between the Trb system of Rhizobium radiobacter and those found in other bacteria:

  • RP4 plasmid system: The trb operon of R. radiobacter shows substantial homology to the corresponding region in RP4 plasmid. Specifically, eleven of the predicted products in the Ti plasmid trb region show significant relatedness to Trb proteins of RP4 .

  • Cross-species conservation: The conjugative transfer system appears to be functionally interchangeable between octopine type plasmid pTi15955 and nopaline/agrocipine type plasmid pTiC58, with virtually identical tra and trb regions .

  • Rhizobium symbiosis plasmids: The complete sequence analysis of symbiosis plasmids from Rhizobium has demonstrated that essentially the same transfer system is present, suggesting evolutionary conservation of this machinery .

This conservation suggests a common evolutionary origin for conjugative transfer systems across diverse bacterial species, with selective pressure maintaining functional components like trbF across divergent lineages.

What regulatory mechanisms control trbF expression and how might they be experimentally manipulated?

The expression of conjugative transfer genes, including trbF, is tightly regulated to minimize metabolic burden on the host bacterium. Several regulatory mechanisms have been identified:

  • Operon organization: The trb genes, including trbF, are organized in a polycistronic operon, allowing coordinated expression of the transfer apparatus components .

  • Transcriptional regulation: In Agrobacterium systems, transcriptional activation of tra and trb operons requires the TraR protein . Additionally, the Ti plasmid system utilizes quorum sensing via N-(3-oxo-octanoyl)-L-homoserine lactone (AAI) produced by TraI .

  • Repression mechanisms: Some conjugative systems employ repressor proteins similar to TrsN in other systems, which modulate rather than completely switch off gene expression .

Experimental manipulation of these regulatory systems might include:

  • Creating inducible expression systems where trbF expression can be triggered by specific environmental signals

  • Developing reporter gene fusions to monitor trbF expression under various conditions

  • Engineering constitutive expression by removing regulatory elements to study the consequences of deregulated trbF production

What strategies can overcome challenges in expressing and purifying hydrophobic proteins like trbF?

The extreme hydrophobicity of trbF presents significant challenges for heterologous expression and purification. Researchers can adopt several strategies to address these challenges:

  • Expression systems optimization:

    • Use of specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Fusion with solubility-enhancing tags (e.g., MBP, SUMO, or TrxA)

    • Lower induction temperatures (16-20°C) to slow protein production and allow proper membrane insertion

  • Extraction and solubilization:

    • Employ mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Consider native membrane extraction using styrene-maleic acid lipid particles (SMALPs)

    • Use bicelles or nanodiscs to maintain the membrane environment

  • Purification considerations:

    • Design purification protocols that maintain detergent concentrations above critical micelle concentration

    • Include glycerol in all buffers to enhance protein stability (as indicated in the storage recommendations)

    • Consider on-column detergent exchange during purification

  • Quality control:

    • Implement rigorous validation of protein folding and functionality post-purification

    • Consider circular dichroism or tryptophan fluorescence to assess structural integrity

These methodological approaches should be optimized specifically for trbF, with careful consideration of its unique structural properties.

How can researchers effectively design functional assays for trbF activity?

Designing functional assays for trbF requires consideration of its role within the complete conjugation machinery:

  • Conjugation frequency assays:

    • Generate trbF mutants and complement with recombinant trbF to measure restoration of conjugation frequency

    • Quantify transfer events using antibiotic resistance markers or fluorescent proteins

    • Compare transfer frequencies under various conditions to assess trbF functionality

  • Membrane incorporation assays:

    • Use fractionation techniques to confirm proper localization of trbF in the membrane

    • Employ fluorescently labeled trbF to visualize membrane localization and potential redistribution during conjugation

  • Protein-protein interaction studies:

    • Design pull-down assays using affinity-tagged trbF to identify interaction partners

    • Implement bacterial two-hybrid screens to systematically evaluate interactions with other Trb proteins

    • Use cross-linking approaches followed by mass spectrometry to capture transient interactions

  • Structure-function analysis:

    • Create systematic mutations in conserved regions to identify essential functional domains

    • Perform targeted modifications of predicted membrane-spanning regions to assess their importance

These assays should be designed with appropriate controls, including comparison to wild-type systems and complementation studies to validate specificity.

How might understanding trbF function contribute to addressing antibiotic resistance spread?

Considering that conjugative transfer is a primary mechanism for horizontal gene transfer, including antibiotic resistance genes, understanding trbF function has significant implications:

  • Targeting conjugation machinery: trbF, as an essential component of the conjugation apparatus, represents a potential target for developing conjugation inhibitors that could reduce the spread of antibiotic resistance genes .

  • Epidemiological relevance: The emerging pathogen status of Rhizobium radiobacter, combined with its ability to acquire resistance through conjugation, highlights the clinical relevance of studying its transfer mechanisms . R. radiobacter has been documented to display acquired resistance to Beta-lactam antibiotics and aminoglycosides .

  • Novel antimicrobial strategies: Rather than directly killing bacteria, which selects for resistance, inhibiting conjugative transfer could reduce the rate of resistance spread without imposing the same selective pressure.

  • Evolutionary considerations: Understanding the conservation and variation in trbF across bacterial species could reveal how conjugation systems adapt to different environmental pressures, providing insights into the evolution of transfer mechanisms.

The development of conjugation inhibitors targeting trbF or its interactions could provide a complementary approach to traditional antibiotics, potentially slowing the spread of resistance determinants in clinical and environmental settings.

What proteomics approaches could advance our understanding of trbF dynamics during conjugation?

Advanced proteomics methodologies offer powerful tools for investigating trbF function within the broader context of bacterial conjugation:

  • Quantitative proteomics: Similar to the approach used in the proteomics study of Rhizobium tropici PRF 81 , researchers could employ techniques like iTRAQ or TMT labeling to quantify changes in trbF expression under different conditions or during various stages of conjugation.

  • Protein-protein interaction networks: Proximity-dependent biotinylation approaches (BioID or APEX) could map the interactome of trbF during active conjugation, potentially identifying previously unknown interaction partners.

  • Post-translational modifications: Mass spectrometry-based analysis could identify potential regulatory modifications of trbF that might control its function or localization during the conjugation process.

  • Structural proteomics: Cross-linking mass spectrometry or hydrogen-deuterium exchange mass spectrometry could provide insights into the structural organization of trbF within the conjugation apparatus.

  • Comparative proteomics: Analysis across different bacterial species could identify conserved and variable features of trbF homologs, informing evolutionary studies and potential broad-spectrum inhibitor design.

Below is a representative table showing how proteomic data for trbF might be presented, modeled after the proteomic profiling data in search result :

ProteinNCBI IDGeneOrganismTheoretical pI/MWObserved pI/MWCellular LocationFunction
Conjugal transfer protein trbFP54914trbFRhizobium radiobacter9.52/24.1 kDa9.6/24 kDaMembraneEssential component of mating pair formation

This integrated proteomics approach would provide a comprehensive understanding of trbF's role within the dynamic process of bacterial conjugation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.