Recombinant Rhizobium radiobacter Conjugal transfer protein trbI (trbI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
trbI; Conjugal transfer protein TrbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-433
Protein Length
full length protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
trbI
Target Protein Sequence
MVQSLNLGGAQNSQAASGIRRINRLPIVVVIVLAVAFLGIIFYGLASRGLYFGRDKGPES SSGEPASTFADQIKRGVTDGIIGEPQQQTTFQPTPVETKQVDEKASNPFTPTPEQRRGQE LEPEAVWRARLEREQQEQYLRERQRQRMARLQANDAAYDAPLAIDRGKLEARTATDDTSA ANTSTAISPTAGASDLYAAALRAGLGGQNIDPNGQKSKEDFFNTDLKDLGYLPNRVVPQQ SLYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSATGHRLLIPQGTKLFGRYDSKV SFGQSRVLVVWSDIIFPNGSTLQIVGMAGTDAEGYGGFKDKVNNHYFKTFGSAVMIALIG TGIDMSVPQSSTLATQDTASDAARRNFAETFGRVADRTIQRNMDVQPTLEIRPGYKFNVL VDQDIIFNGIYRN
Uniprot No.

Target Background

Protein Families
TrbI/VirB10 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the conjugal transfer protein trbI in Rhizobium radiobacter?

TrbI is a critical component of the type IV secretion system (T4SS) in Rhizobium radiobacter (formerly known as Agrobacterium tumefaciens). It functions as part of the machinery that facilitates bacterial conjugation - the process of transferring single-stranded plasmid DNA from donor to recipient cells. The T4SS forms a complex secretion channel through which this DNA transfer occurs, and trbI contributes to the structural assembly of this channel . TrbI is encoded within the conjugation gene cluster and works alongside other Trb proteins to form a functional conjugative apparatus.

How does trbI relate to the pathogenicity of Rhizobium radiobacter?

Rhizobium radiobacter is the causative agent of stem and crown gall disease in plants, including highbush blueberry (Vaccinium corymbosum) . While trbI itself isn't directly responsible for pathogenicity, it plays a supportive role in the bacterial lifestyle that enables pathogenicity. The conjugation system that includes trbI facilitates the transfer of virulence factors, particularly the tumor-inducing (Ti) plasmid that contains transfer DNA (T-DNA). Once integrated into the plant genome, this T-DNA disrupts the balance of plant growth hormones such as auxin and cytokinin, resulting in abnormal cell growth that develops into tumor-like galls .

What is the relationship between trbI and other components of the type IV secretion system?

TrbI functions as part of an integrated protein complex within the T4SS. It interacts with several other Trb proteins to form the conjugation pilus and secretion channel. In particular, trbI coordinates with proteins like trbB (which provides ATP-dependent assembly functions) and trbC (involved in pilus biogenesis). It also has functional interactions with relaxase proteins such as TraA, which initiates conjugation by nicking and unwinding double-stranded DNA to produce the single-stranded DNA that gets transferred . This coordinated protein interaction network is essential for successful conjugative DNA transfer.

What are the optimal conditions for expressing recombinant trbI protein?

The optimal expression of recombinant trbI protein requires careful consideration of expression systems and conditions:

ParameterRecommended ConditionsNotes
Expression hostE. coli BL21(DE3)Protease-deficient strain improves yield
Vector systempET or pBAD seriesInducible expression preferred
Growth temperature25-28°CSimilar to native growth temp of R. radiobacter (26°C)
Induction protocol0.1-0.5 mM IPTG, OD600=0.5-0.7Lower concentrations reduce toxicity
Post-induction time4-6 hoursLonger times may lead to degradation
MediaLB with reduced saltHelps with membrane protein expression
Additives0.5-1% glucose pre-inductionReduces basal expression

Temperature control is particularly important, as higher temperatures often lead to inclusion body formation, while cultivation at approximately 26°C (similar to R. radiobacter's optimal growth temperature) promotes proper folding .

How can researchers design a conjugation assay to study trbI function?

A robust conjugation assay based on methodologies described in current research includes:

  • Strain preparation:

    • Donor strain: Wild-type or modified R. radiobacter containing a transmissible plasmid with selectable marker (e.g., pBIN-GUSINT with kanamycin resistance)

    • Recipient strain: R. radiobacter with different antibiotic resistance (e.g., chloramphenicol or ampicillin)

    • Experimental strains: trbI knockout or modified variants

  • Conjugation protocol:

    • Grow donor and recipient strains to OD600≈1.0

    • Wash cells three times with appropriate medium (AB medium recommended)

    • Mix equal volumes of donor and recipient cells

    • Incubate for conjugation (24h at 26°C is standard)

    • Plate dilutions on selective media containing antibiotics for both donor and recipient markers

  • Quantification:

    • Count colonies after 2-3 days incubation

    • Calculate conjugation efficiency as transconjugants per donor cell

    • Compare experimental variants to wild-type controls

This standardized approach allows for direct comparison between wild-type trbI and mutant variants to assess functional importance .

What purification strategies are most effective for recombinant trbI?

Purification of recombinant trbI requires specialized approaches due to its membrane-associated nature:

Purification StepMethodConditions
Cell lysisFrench press or sonicationIn buffer with protease inhibitors
Membrane extractionDetergent solubilization1% DDM or 1% LDAO, 4°C, 1 hour
Initial purificationAffinity chromatographyNi-NTA for His-tagged protein
Secondary purificationIon exchangeBased on theoretical pI
Final purificationSize exclusionSuperdex 200, buffer with 0.05% DDM

Critical considerations include:

  • Maintaining detergent above critical micelle concentration throughout purification

  • Performing all steps at 4°C to prevent protein degradation

  • Including stabilizing agents such as glycerol (10%) in all buffers

  • Testing protein activity after each purification step to ensure functionality is maintained

How do mutations in trbI affect conjugation efficiency and plasmid transfer?

Mutational studies of trbI provide crucial insights into structure-function relationships:

Mutation TypeTypical Effect on ConjugationExperimental Observation
Null mutation (knockout)Complete abolishment>99.9% reduction in transfer efficiency
Transmembrane domain mutationsSevere impairment100-1000 fold reduction
Periplasmic domain mutationsModerate impairment10-100 fold reduction
Cytoplasmic domain mutationsVariable effectsDepends on specific residue
Conservative substitutionsMinimal impactOften retains >50% function

When designing mutational studies, researchers should:

  • Target highly conserved residues identified through sequence alignment

  • Use complementation assays in trbI-deficient backgrounds

  • Quantify conjugation efficiency using standardized protocols

  • Verify proper protein expression and localization of mutant variants

The conjugation efficiency differences between wild-type and mutant strains can be assessed using methods similar to those described for testing phage efficacy against R. radiobacter, where growth inhibition is monitored over time (e.g., measurements at 12, 24, 36, and 48 hours) .

What is the relationship between trbI function and phage susceptibility in R. radiobacter?

Recent research has identified interesting connections between conjugation systems and phage susceptibility:

  • Structural similarities:

    • The T4SS apparatus that includes trbI shares structural similarities with phage injection machinery

    • Some phages specifically target components of conjugation systems as receptors

  • Experimental findings:

    • Phage susceptibility profiles can vary significantly between different R. radiobacter strains

    • Of 76 bacteriophages tested against R. radiobacter strains, 18 showed the ability to lyse at least 53.57% of strains, while 10 could lyse at least 75% of strains

    • This variability may correlate with differences in conjugation system components including trbI

  • Research approach:

    • Compare phage susceptibility between wild-type and trbI-modified strains

    • Sequence trbI in strains with different phage susceptibility profiles

    • Assess whether phage infection alters expression of conjugation genes

This emerging research area may provide new insights into both phage biology and bacterial conjugation systems .

How does environmental signaling regulate trbI expression and function?

The regulation of conjugal transfer systems responds to multiple environmental cues:

  • Known regulatory factors:

    • Temperature (conjugation efficiency peaks around 26-28°C)

    • Cell density (quorum sensing)

    • Nutrient availability

    • Light (through photoreceptors in related Agrobacterium species)

  • Regulatory mechanisms:

    • Transcriptional control of trbI expression

    • Post-translational modifications affecting protein activity

    • Protein-protein interactions modulating complex assembly

  • Experimental evidence:

    • In Agrobacterium fabrum, conjugation is modulated by phytochromes Agp1 and Agp2, which are photoreceptors sensitive to red light

    • Temperature affects Ti plasmid propagation, with elevated temperatures (37°C) slowing down propagation

These regulatory mechanisms ensure that energy-intensive conjugation processes occur only under favorable conditions, representing an important area for future research .

How should researchers quantify and analyze conjugation efficiency data?

  • Recommended quantification metrics:

    • Absolute transfer frequency (transconjugants per recipient)

    • Relative transfer frequency (compared to wild-type control)

    • Kinetics of transfer (time-course measurements)

  • Statistical approaches:

    • Log-transform conjugation frequency data before statistical analysis (frequencies typically span several orders of magnitude)

    • Use t-tests for comparing two conditions

    • Apply ANOVA with post-hoc tests for multiple condition comparisons

    • Include at least three independent biological replicates

  • Data presentation:

    • Use log-scale plots for wide-ranging efficiency data

    • Include appropriate error bars representing standard deviation or standard error

    • Present raw data alongside transformed data when possible

When analyzing conjugation efficiency data, researchers should consider potential confounding factors such as growth rate differences between strains, which may be monitored similarly to the measurements used in phage efficacy studies .

How can researchers resolve contradictory results in trbI functional studies?

When faced with contradictory experimental outcomes:

  • Examine experimental variables:

    • Temperature (optimal around 26°C)

    • Media composition (differences between LB and AB media)

    • Growth phase of bacterial cultures

    • Incubation conditions (static vs. shaking at 100 rpm)

  • Consider strain-specific factors:

    • Presence/absence of Ti plasmid (can be verified by PCR)

    • Genetic background differences

    • Expression levels of trbI and interacting partners

  • Perform complementary assays:

    • Direct protein interaction studies (bacterial two-hybrid, co-immunoprecipitation)

    • Protein localization (fluorescence microscopy)

    • RNA-seq to assess global expression patterns

  • Technical validation:

    • Sequence verification of all experimental strains

    • Confirmation of protein expression levels

    • Independent replication in different laboratories

Careful consideration of these factors can help reconcile seemingly contradictory results and build a more coherent understanding of trbI function .

What bioinformatic approaches can help characterize trbI and predict its interactions?

Advanced bioinformatic methods offer valuable insights into trbI function:

  • Sequence analysis:

    • Multiple sequence alignment to identify conserved residues

    • Domain prediction to map functional regions

    • Phylogenetic analysis to understand evolutionary relationships

  • Structural prediction:

    • Homology modeling based on related proteins

    • Ab initio structure prediction for unique domains

    • Molecular dynamics simulations to assess conformational changes

  • Interaction prediction:

    • Protein-protein interaction databases

    • Co-evolution analysis to identify interacting partners

    • Docking simulations with potential partners

  • Genomic context analysis:

    • Gene neighborhood analysis across bacterial species

    • Codistribution patterns of trbI with other genes

    • As shown in source data, TraA (a key protein in conjugation) shows codistribution with Agp1/Agp2 phytochromes in 43 Rhizobiales species

These computational approaches can guide experimental design and help interpret experimental results in a broader biological context.

How might CRISPR-Cas9 technology advance the study of trbI function?

CRISPR-Cas9 technology offers powerful new approaches for studying trbI:

  • Precise genome editing applications:

    • Clean deletion of trbI without polar effects on other genes

    • Introduction of point mutations to study specific residues

    • Creation of fluorescent protein fusions at the endogenous locus

  • Regulatory studies:

    • CRISPRi (dCas9-based repression) for conditional knockdown

    • CRISPRa (dCas9-based activation) to increase expression

    • Targeting of regulatory regions to study transcriptional control

  • High-throughput applications:

    • CRISPR libraries targeting all residues in trbI

    • Parallel assessment of conjugation efficiency

    • Screen for residues affecting phage susceptibility

  • Implementation considerations:

    • Optimization of CRISPR-Cas9 delivery for Rhizobium

    • Design of guides with minimal off-target effects

    • Selection of appropriate Cas variants for specific applications

CRISPR technologies permit unprecedented precision in genetic manipulation, enabling more sophisticated studies of trbI function than previously possible.

What potential exists for engineering trbI to create novel conjugation systems?

Protein engineering of trbI offers exciting possibilities:

  • Enhanced conjugation systems:

    • Increased transfer efficiency for biotechnology applications

    • Expanded host range for wider applicability

    • Conditional activation for controlled DNA transfer

  • Biosafety applications:

    • Engineering safeguards to prevent unintended horizontal gene transfer

    • Creating biological containment systems

    • Developing conditional systems activated only under specific conditions

  • Biotechnological applications:

    • Targeted DNA delivery to specific bacterial recipients

    • Development of novel bacterial transformation tools

    • Creation of engineered bacterial communities with controlled gene exchange

  • Experimental approach:

    • Rational design based on structural insights

    • Directed evolution for desired properties

    • Domain swapping with related proteins from other secretion systems

Engineering efforts should consider the lessons learned from phage studies, where cocktails of multiple phages showed greater efficiency and stability than single phage treatments .

How does trbI contribute to the ecological dynamics of R. radiobacter populations?

Understanding the ecological role of conjugation systems provides important context:

  • Population dynamics:

    • Horizontal gene transfer mediated by trbI affects population diversity

    • Spread of beneficial traits (including resistance genes) under selective pressure

    • Co-evolution with bacteriophages that may target conjugation machinery

  • Plant-microbe interactions:

    • Role in adaptation to different plant hosts

    • Transfer of genes relevant to plant colonization

    • Impact on pathogenicity and gall formation

  • Environmental adaptations:

    • Response to changing environmental conditions

    • Seasonal variations in conjugation activity

    • Light-mediated regulation through photoreceptor systems

  • Research approaches:

    • Metagenomic analysis of natural populations

    • Microcosm experiments with engineered strains

    • Long-term evolution experiments under different selection regimes

This ecological perspective is essential for understanding the full biological significance of trbI and the conjugation systems it supports.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.