Recombinant Rhizobium radiobacter Protein virB2 (virB2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Pathogenesis

virB2 constitutes the primary structural subunit of the T-pilus, a filamentous appendage critical for:

  • Host cell attachment: Mediates physical contact between Agrobacterium and plant membranes

  • T-DNA transfer: Facilitates interkingdom genetic material delivery via the T4SS

  • Plant protein interactions: Binds Arabidopsis reticulon-like proteins (RTNLB1, RTNLB2, RTNLB4) and GTPase AtRAB8 to enhance transformation efficiency

In vitro studies demonstrate virB2 self-assembles into pilus-like structures and forms complexes with plant proteins BTI1, BTI2, and BTI3 through yeast two-hybrid and GST pull-down assays .

Mechanism of Plant Cell Transformation

Pretreatment of Arabidopsis cells with recombinant virB2 reduces transformation efficiency by 40–60%, confirming its role in early host-pathogen recognition . The protein shows calcium-dependent binding to plant cell wall components via rhicadhesin-like domains .

Host Interaction Partners

Identified plant proteins interacting with virB2:

Plant ProteinInteraction TypeFunctional Impact
RTNLB1/2/4Yeast two-hybridIncreases transformation susceptibility
AtRAB8 GTPaseIn vitro bindingRegulates membrane trafficking
BTI1/2/3GST pull-down assaysModifies T-pilus attachment kinetics

Technical Considerations

  • Activity preservation: Requires reconstitution at 0.1–1.0 mg/mL with ≤50% glycerol

  • Functional assays: Optimal activity observed with 100 μM acetosyringone induction

  • Commercial availability: Catalog No. RFL28222RF (Creative Biomart)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation in development.
Synonyms
virB2; Protein virB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-121
Protein Length
Full Length of Mature Protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
virB2
Target Protein Sequence
MMRVISSCAPSLGGAMAWSISSCGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRRSLGLVAGVVGGIVIMFGASFLGQTLTGGS
Uniprot No.

Target Background

Function
VirB proteins are believed to function at the bacterial surface, playing a critical role in directing T-DNA transfer to plant cells.
Protein Families
VirB2 family
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.

Q&A

How is VirB2 processed in bacterial cells?

VirB2 is initially synthesized as a 121-amino acid propilin, which requires processing to form the functional T-pilus subunit. The processing involves:

  • Removal of 47 amino acid residues from the N-terminal portion to form a 7.2 kDa processed protein

  • The predicted cleavage site in A. tumefaciens is between alanine and glutamine in the sequence -Pro-Ala-Ala-Ala-Glu-Ser-

  • Unlike earlier hypotheses, high-resolution structural studies have revealed that the pilin subunit is not cyclized by the formation of a peptide bond between the two ends of the polypeptide

While processing occurs similarly in both A. tumefaciens and E. coli, the precise cleavage sites appear to differ slightly between these organisms, though the final products are similar in size .

What is the relationship between VirB2 and the T-pilus?

VirB2 is the major structural component (pilin subunit) of the T-pilus, which is essential for the transfer of T-DNA from A. tumefaciens to plant cells. The relationship can be characterized as follows:

  • Processed VirB2 (7.2 kDa) constitutes the major protein found in purified T-pilus preparations

  • The presence of exocellular VirB2 directly correlates with T-pilus formation

  • Export of processed VirB2 requires other virB genes, as mutations in these genes result in processed VirB2 accumulation in the cell rather than pilus formation

  • The T-pilus serves as a conjugative structure that enables the promiscuous transfer of genetic material to plant hosts

The T-pilus has been termed "promiscuous" because it can mediate transfer of T-DNA to different organisms, including yeasts and plants .

What are the optimal conditions for expressing and purifying recombinant VirB2?

Based on established protocols for recombinant VirB2 production:

  • Expression System: E. coli is the preferred expression system for recombinant VirB2 production

  • Protein Tag: His-tag fused to the N-terminal portion facilitates purification while maintaining protein functionality

  • Storage Conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

Research indicates that VirB2 processing occurs effectively in E. coli, making it a suitable host for recombinant production, though the precise cleavage site may differ from that in A. tumefaciens .

How can researchers detect and analyze VirB2 expression and localization?

Several complementary techniques can be employed to detect and analyze VirB2 expression and localization:

  • Western Blot Analysis:

    • Use VirB2-specific antibodies to detect both the holoprotein and processed forms

    • Tricine-SDS-PAGE is preferable for separating the 7.2 kDa processed form

    • Include controls such as Ros antibody (for cytoplasmic protein detection) to confirm that exocellular VirB2 is not due to cell lysis

  • Fractionation Protocols:

    • Separate cellular fractions (cytoplasmic, membrane, exocellular) to determine VirB2 localization

    • The processed VirB2 is primarily localized to the cytoplasmic membrane

    • Exocellular VirB2 can be collected from culture supernatants by filtration and concentration

  • Electron Microscopy:

    • Negative staining can visualize T-pili on bacterial cells

    • Immunogold labeling with VirB2-specific antibodies confirms VirB2 presence in pilus structures

  • Temperature Considerations:

    • VirB2 production is significantly enhanced (approximately 20-fold) at 19°C compared to 28°C

    • This parallels the increased T-pilus formation observed at lower temperatures

Functional Studies and Mutations

VirB2 functions within a complex system of VirB proteins that form the type IV secretion system (T4SS):

  • Processing Independence: The processing of VirB2 propilin is not dependent on an intact functional VirB channel, as VirB2 processing still occurs in mutants of other virB genes

  • Export Dependence: While processing is independent, the export of processed VirB2 requires other VirB proteins. In virB mutants, processed VirB2 accumulates within the cellular confines but is not exported

  • Functional Interdependence:

    • VirB2 requires proper assembly of the T4SS channel composed of other VirB proteins for its function

    • The T-pilus contains VirB2 as its major component, but may incorporate other proteins such as VirB1*

    • Mutations in virB9, virB10, and virB11 can result in reduced virulence even in the absence of detectable pili, but still require functional VirB2

  • VirB Operon Components: The VirB proteins work cooperatively to form the complete T4SS apparatus. VirB6, VirB7, VirB8, VirB9, and VirB10 likely encode components of the transporter that move VirB2 subunits across the plasma membrane

How can researchers use VirB2 mutations to dissect T-pilus function from T-DNA transfer?

Certain VirB2 mutations allow researchers to distinguish between T-pilus formation and T-DNA transfer capabilities:

  • Uncoupling Mutations:

    • Mutations such as L94A and A110G produce the Vir+, Pil- phenotype, meaning they maintain virulence but do not form detectable T-pili

    • These uncoupling mutations provide valuable tools for investigating the specific role of the T-pilus in conjugation

  • Experimental Approaches:

    • Transient transformation assays can assess the efficiency of T-DNA transfer in the absence of T-pilus formation

    • Using GUS reporter systems, the transformation efficiency of different VirB2 mutants can be quantified in plant models such as Arabidopsis seedlings

    • Comparing wounded versus unwounded plant tissues can further dissect the contribution of the T-pilus to different stages of the transformation process

  • Research Applications:

    • Determining whether the T-pilus primarily functions in initial attachment to plant cells or in the actual DNA transfer process

    • Investigating whether direct cell-to-cell contact can bypass the need for the T-pilus under certain conditions

    • Developing optimized Agrobacterium strains for plant transformation with enhanced efficiency

What is the structure-function relationship of the luminal loop in VirB2 and how does it impact T-pilus assembly?

Recent structural studies have revealed important insights about the luminal loop in VirB2:

  • Structural Features:

    • VirB2 contains a critical luminal loop featuring an arginine residue (R91) that forms electrostatic interactions within the T-pilus lumen

    • The guanidino groups of R91 interact with phosphate groups, creating a network of electrostatic interactions with no net charge in the lumen

  • Functional Significance:

    • Mutations R91E and R91A completely destabilize VirB2, preventing T-pilus formation and abolishing virulence

    • The S93A mutation in the luminal loop allows VirB2 stability but reduces its abundance, resulting in reduced virulence

  • Mechanistic Implications:

    • The luminal loop appears crucial for maintaining the structural integrity of VirB2 and enabling proper T-pilus assembly

    • Electrostatic interactions within the pilus lumen likely contribute to the stability and functionality of the assembled structure

These findings highlight the importance of specific structural elements in VirB2 for T-pilus assembly and function, providing targets for further structural and functional studies.

How does temperature affect VirB2 expression and T-pilus formation, and what are the implications for experimental design?

Temperature has a significant impact on VirB2 expression and T-pilus formation:

  • Temperature Effects:

    • Exocellular VirB2 is produced approximately 20-fold more abundantly at 19°C compared to 28°C

    • This temperature effect on VirB2 production parallels the increased formation of vir gene-specific pili at lower temperatures

    • A. tumefaciens grows optimally at 28°C but experiences heat shock at temperatures above 30°C, potentially affecting VirB2 processing and T-pilus assembly

  • Experimental Considerations:

    • Researchers should carefully control temperature when studying VirB2 and T-pilus formation

    • For maximum T-pilus production, incubation at 19°C is recommended despite being suboptimal for bacterial growth

    • The doubling time of A. tumefaciens can range from 2.5-4 hours depending on media, culture format, and aeration level

  • Mechanistic Implications:

    • The temperature dependence suggests regulatory mechanisms that may prioritize T-pilus formation under specific environmental conditions

    • This may reflect an adaptation to optimize the infection process in natural environments where temperatures fluctuate

  • Applications in Transformation Protocols:

    • Researchers developing plant transformation protocols using Agrobacterium should consider temperature optimization to maximize transformation efficiency

    • Pre-incubation of Agrobacterium cultures at lower temperatures prior to plant infection may enhance T-pilus formation and transformation success

How does VirB2 compare with similar proteins in other bacterial secretion systems?

VirB2 shares structural and functional similarities with proteins from other bacterial secretion systems:

Understanding these evolutionary relationships can inform research on bacterial pathogenesis mechanisms and potential broad-spectrum intervention strategies.

How can researchers differentiate between the functions of VirB2 and other virulence factors in experimental systems?

Differentiating the specific functions of VirB2 from other virulence factors requires careful experimental design:

  • Genetic Approaches:

    • Use of nonpolar deletion mutations is critical to avoid polar effects on downstream genes in the virB operon

    • Complementation experiments with wild-type VirB2 can confirm that observed phenotypes are specifically due to VirB2 loss

    • Expression analysis of downstream genes (e.g., virB5) can verify that mutations are truly nonpolar

  • Functional Assays:

    • T-pilus formation can be assessed by electron microscopy and immunoblotting of exocellular fractions

    • Virulence can be tested through plant tumor formation assays (e.g., Kalanchoe daigremontiana leaf infection)

    • Transient transformation efficiency using reporter genes (e.g., GUS) provides quantitative assessment of T-DNA transfer capabilities

  • Specific VirB2 Effects:

    • Comparing mutants that maintain some functions while losing others (e.g., Vir+/Pil- phenotypes) helps dissect the specific contributions of VirB2

    • Temperature modulation experiments can specifically enhance VirB2 expression and T-pilus formation without affecting other virulence factors

    • Flagellum-free strains (e.g., NT1REB) can be used to eliminate potential interference from flagellin when studying VirB2 and the T-pilus

This multi-faceted approach enables researchers to attribute specific phenotypes to VirB2 function with confidence.

What are promising approaches for studying the dynamics of VirB2 assembly into the T-pilus?

Several cutting-edge approaches show promise for advancing our understanding of VirB2 assembly dynamics:

  • Advanced Imaging Techniques:

    • Cryo-electron microscopy (cryo-EM) has already provided insights into T-pilus structure and could be further applied to capture assembly intermediates

    • Super-resolution microscopy could track VirB2 localization and assembly in real-time in living cells

    • Single-molecule fluorescence techniques might reveal the kinetics of VirB2 incorporation into growing pili

  • Dynamic Structural Studies:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) could probe conformational changes during VirB2 processing and assembly

    • Cross-linking mass spectrometry (XL-MS) might identify key interaction interfaces between VirB2 and other VirB proteins during assembly

    • Time-resolved structural studies could capture the full assembly pathway

  • Synthetic Biology Approaches:

    • Designer VirB2 variants with site-specific modifications could test specific hypotheses about assembly mechanisms

    • Minimal synthetic systems reconstituting T-pilus assembly in vitro might isolate the essential components and conditions required

    • Chimeric proteins combining domains from different pilus systems could reveal functional equivalence or divergence of specific regions

These approaches could significantly enhance our understanding of the dynamic process of T-pilus formation and function.

How might researchers exploit VirB2 knowledge to enhance plant transformation methods?

Understanding VirB2 function offers several potential avenues for improving plant transformation technologies:

  • Optimized VirB2 Variants:

    • Engineering VirB2 proteins with enhanced stability or assembly properties could improve transformation efficiency

    • Uncoupling mutations that maintain virulence while altering other properties might be leveraged to develop specialized transformation strains

    • Structure-guided modifications to enhance specific interactions with plant cell surfaces could improve target specificity

  • Protocol Optimizations:

    • Temperature modulation during bacterial growth and plant infection stages could maximize VirB2 expression and T-pilus formation

    • Pre-induction protocols that optimize VirB2 processing and export prior to plant infection might enhance transformation outcomes

    • The differential requirements for T-pilus in wounded versus unwounded tissues could inform tissue preparation strategies

  • Expanded Host Range Applications:

    • The promiscuous nature of the T-pilus suggests potential for expanding the host range of Agrobacterium-mediated transformation

    • Understanding the molecular basis of host recognition could enable the development of modified VirB2 proteins with altered host specificity

    • Combined approaches targeting both the T-pilus and other aspects of the T-DNA transfer process could overcome recalcitrance in challenging plant species

These applications could significantly advance plant biotechnology and genetic engineering capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.