Recombinant Rhizobium radiobacter Protein virB3 (virB3)

Shipped with Ice Packs
In Stock

Description

Biological Role

virB3 is a component of the Type IV secretion system (T4SS) in Rhizobium radiobacter (syn. Agrobacterium tumefaciens), enabling horizontal gene transfer and virulence factor delivery . This system is critical for:

  • Plasmid conjugation

  • Host cell transformation via T-DNA transfer

  • Pathogen-host interactions in plants

Comparative genomic studies highlight its conservation in related species like Brucella and Bartonella, where it facilitates intracellular survival .

Research Applications

This recombinant protein is utilized in:

  • Mechanistic studies of bacterial secretion systems

  • Protein-protein interaction assays (e.g., yeast two-hybrid, co-IP)

  • Antigen production for antibody development

  • Structural biology to resolve T4SS assembly dynamics

Handling and Stability

  • Storage: Lyophilized powder is stable for 12 months at -80°C; avoid repeated freeze-thaw cycles .

  • Buffer compatibility: Tris/PBS-based formulations at pH 8.0 optimize solubility .

  • Activity validation: Functional assays (e.g., ATPase activity, secretion efficiency) are recommended for application-specific verification .

Limitations and Future Directions

Current research gaps include:

  • Detailed structural data for virB3 in complex with other T4SS components

  • Host-specific interaction partners in non-model plants

  • Role in antibiotic resistance dissemination

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
virB3; Protein virB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
virB3
Target Protein Sequence
MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARL IVERDYNAASVVLLFLRTAGRSIDSAVWGGATVSPNPIRVPPRGRGMV
Uniprot No.

Target Background

Function
VirB proteins are thought to function at the bacterial surface, playing a crucial role in directing T-DNA transfer to plant cells.
Gene References Into Functions
  1. Agrobacterium tumefaciens type IV secretion protein VirB3 is an inner membrane protein and requires VirB4, VirB7, and VirB8 for stabilization. PMID: 20348257
Protein Families
VirB3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is the virB3 gene organized and expressed in the Rhizobium radiobacter genome?

The virB3 gene is part of the virB operon located on the tumor-inducing (Ti) plasmid of Rhizobium radiobacter. Studies have shown that virB3 is typically constructed through a two-step cloning process:

  • Amplification of 1-kb up- and downstream fragments using specific primers

  • Cloning of these fragments into vectors such as pCR2.1 TOPO or pBluescript

The gene can be expressed under the control of the virD promoter (virDp) by incorporating a C→A substitution to improve the ribosome binding site sequence. This modification is achieved using forward amplification primers such as 5′-GGGGGTCGACGAGGTAGTTGATGAATGATCG-3′, where the SalI site and the virB3 start codon are underlined and the substitution is in bold .

For recombinant expression in laboratory settings, the virB3 gene is commonly expressed in E. coli systems with tags (typically His-tag) fused to its N-terminus to facilitate purification .

What are the structural characteristics and membrane topology of VirB3 protein?

VirB3 is a membrane protein with distinctive structural features that enable its function in the T4SS. Key structural characteristics include:

FeatureDescription
Amino acid length108 amino acids (full length)
Molecular weightApproximately 10-12 kDa
Membrane domainsTwo transmembrane domains (TMDs)
TopologyBoth N and C termini reside in the cytoplasm
Cellular localizationInner membrane protein
Polar localizationLocalizes to a cell pole

This topology was determined using PhoA and green fluorescent protein (GFP) as periplasmic and cytoplasmic reporters, respectively. Fusion proteins with GFP at either the N or C terminus of VirB3 were fluorescent, confirming that both termini are cytoplasmic. Biochemical fractionation studies demonstrated that VirB3 proteins encoded by three different Ti plasmids (pTiA6NC, pTiBo542, and pTiC58) are all inner membrane proteins .

What is the function of VirB3 in the Type IV Secretion System pathway?

VirB3 plays a crucial role in the assembly and function of the T4SS translocation channel. Through a modified chromatin immunoprecipitation assay called Transfer DNA Immunoprecipitation (TrIP), researchers have mapped the route of DNA transfer through the VirB/VirD4 T4SS .

The sequential pathway of T-DNA transfer through the T4SS components is:

  • VirD4 (substrate receptor)

  • VirB11 (ATPase)

  • VirB6 (inner membrane channel component)

  • VirB8 (channel component)

  • VirB2 (major pilin)

  • VirB9 (outer membrane component)

While VirB3 does not directly cross-link with the DNA substrate, null mutations in virB3 block the formation of specific substrate-channel subunit contacts in the transfer pathway, establishing its importance for specific stages of substrate translocation . This suggests that VirB3 plays a structural or regulatory role in the assembly of functional T4SS complexes rather than directly participating in substrate binding.

How does VirB3 interact with other VirB proteins to form a functional secretion system?

VirB3 forms key interactions with several other VirB proteins to establish a functional T4SS. Most notably:

  • VirB3-VirB4 interaction: VirB4 is essential for the stabilization of VirB3. In the pTiC58 plasmid, VirB4 was found to be crucial for maintaining VirB3 stability .

  • VirB3-VirB7-VirB8 complex: For pTiA6NC VirB3, stabilization requires not only VirB4 but also VirB7 and VirB8. This suggests that a binary interaction between VirB3 and any single one of these proteins (VirB4/VirB7/VirB8) is not sufficient for VirB3 stabilization .

  • Membrane association: VirB3 associates with the inner membrane, similar to the VirB2 pilin. This co-localization suggests functional cooperation between these proteins .

Researchers hypothesize that bacteria use selective proteolysis as a mechanism to prevent assembly of unproductive precursor complexes under conditions that do not favor assembly of large macromolecular structures . This would explain why VirB3 requires multiple interaction partners for stability.

What methods are used to express and purify recombinant VirB3 protein for in vitro studies?

Recombinant VirB3 protein is typically expressed and purified using the following methodological approach:

StepMethodology
Expression systemE. coli bacterial expression system
Expression constructFull-length virB3 gene (1-108aa) with N-terminal His-tag
Purification methodAffinity chromatography using the His-tag
Final formLyophilized powder
Purity>90% as determined by SDS-PAGE

For optimal storage and reconstitution:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

For fusion protein studies, the virB3 coding region can be amplified by PCR and cloned into vectors allowing N-terminal or C-terminal fusion tags. For example, GFP-VirB3 fusions can be constructed by cloning virB3 (codon 2 to the end) as an XbaI fragment into a GFP-containing vector, while VirB3-GFP fusions can be created by cloning virB3 (codons 2 to 108) without the translation stop codon as an XhoI fragment .

How can researchers verify the functionality of recombinant VirB3 protein in experimental settings?

Verifying the functionality of recombinant VirB3 protein requires multiple complementary approaches:

  • Complementation assays: Introducing recombinant virB3 into virB3-deficient bacterial strains should restore T-DNA transfer and virulence capabilities. The efficiency of complementation can be measured by quantifying tumor formation on susceptible plants .

  • Protein-protein interaction studies: Since VirB3 functionality depends on interactions with VirB4, VirB7, and VirB8, co-immunoprecipitation or yeast two-hybrid assays can verify if the recombinant protein maintains these critical interactions .

  • Subcellular localization: Using fluorescence microscopy with GFP-tagged VirB3, researchers can confirm proper localization to the cell pole and inner membrane, which is essential for function .

  • Membrane topology analysis: PhoA fusion assays can be used to verify the correct membrane topology (two transmembrane domains with both N and C termini in the cytoplasm) .

  • T-pilus assembly assays: Since VirB3 is required for T-pilus assembly, the presence of extracellular VirB2 (the major pilin) can serve as an indirect indicator of VirB3 functionality .

What are the current approaches for studying VirB3's role in bacterial pathogenicity?

Several methodological approaches are employed to investigate VirB3's role in pathogenicity:

  • Genetic deletion studies: Creating virB3 knockout strains and assessing their virulence in plant models provides direct evidence of VirB3's role in pathogenicity .

  • Bacteriophage-based control: Recent studies have identified bacteriophages that can infect Rhizobium radiobacter, potentially offering a biological control method. A three-phage cocktail (IC12, IG49, and LG08) has shown promising results in controlling R. radiobacter strains in vitro and in soil/peat-based models .

  • Carrot slice and plant inoculation assays: To test the pathogenicity of R. radiobacter isolates, researchers use carrot slices, squash fruits, kalanchoe leaves, and various seedlings and rootstocks. These assays can compare wild-type and virB3-mutant strains to assess virulence .

  • Transfer DNA Immunoprecipitation (TrIP): This modified chromatin immunoprecipitation assay allows researchers to identify which T4SS components contact the translocating T-DNA, helping map the transfer pathway .

  • Host range determination: Testing the ability of different R. radiobacter strains to infect various plant species can provide insights into the specificity and efficiency of the T4SS dependent on functional VirB3 .

How does VirB3 contribute to the bacterial adaptation in different environments?

VirB3's contribution to bacterial adaptation spans multiple ecological contexts:

  • Plant-microbe interactions: The VirB3 protein, as part of the T4SS, enables R. radiobacter to genetically transform plant cells, creating an ecological niche where the bacterium can exploit plant resources through induced gall formation .

  • Soil persistence: While R. radiobacter is found primarily in soil environments and plant roots, its T4SS may contribute to survival by facilitating horizontal gene transfer under stress conditions .

  • Opportunistic human infections: Interestingly, R. radiobacter can occasionally cause opportunistic infections in humans, particularly in immunocompromised individuals with indwelling medical devices. These infections include central line-associated bloodstream infections, peritonitis, and rarely endophthalmitis or endocarditis . The role of VirB3 in these human infections remains under investigation.

  • Environmental stability: Studies comparing Rhizobium species with Agrobacterium suggest that Rhizobia display minimal survival in ground water and sewage, are inadequately found in desiccation and sunlight, and exhibit less dispersal through soil and water . These characteristics may be influenced by the T4SS functionality.

  • Biofilm formation: Like other plant-associated bacteria, R. radiobacter can form biofilms by secreting sticky polysaccharide envelopes, a process that may be regulated by T4SS components including VirB3 .

What model systems are most effective for studying VirB3 function?

Several model systems have proven effective for studying VirB3 function:

Model SystemApplicationsAdvantages
E. coli expression systemsProtein production, structure-function studiesWell-established protocols, high yield
Plant infection modelsPathogenicity studiesDirect relevance to natural host-pathogen interactions
Carrot disc assayRapid virulence testingSimple, reproducible, quantifiable
GFP fusion systemsLocalization studiesVisual confirmation of protein localization
PhoA fusion systemsMembrane topology analysisReliable determination of protein orientation
Yeast two-hybridProtein-protein interaction studiesIdentification of interaction partners
Cell fractionation studiesSubcellular localizationBiochemical verification of membrane association
TrIP assayT-DNA transfer pathway mappingDirect evidence of substrate translocation route

For specific plant models, researchers have successfully used:

  • Highbush blueberry (Vaccinium corymbosum)

  • Carrot slices

  • Squash fruits

  • Kalanchoe leaves

  • Tomato and sunflower seedlings

  • GF677, M9, and MM106 rootstocks

How do mutations in virB3 affect the assembly and function of the Type IV Secretion System?

Mutations in virB3 have profound effects on T4SS assembly and function, with implications that extend beyond the protein itself:

  • Complete loss of function: Deletion of virB3 abolishes both T-pilus assembly and T-DNA secretion, rendering the bacterium avirulent . This indicates that VirB3, unlike VirB7, is essential for T4SS functionality.

  • Disruption of protein interactions: Mutations in virB3 can disrupt critical interactions with VirB4, VirB7, and VirB8, leading to protein instability and degradation . This suggests that the proper folding and stability of VirB3 depends on these interactions.

  • Impact on substrate translocation pathway: While VirB3 does not directly contact the T-DNA substrate during translocation, mutations in virB3 block the formation of substrate contacts with other channel components downstream in the pathway . This indicates that VirB3 is crucial for the proper assembly of the channel architecture.

  • Membrane topology alterations: Mutations affecting the transmembrane domains of VirB3 can alter its membrane topology, preventing proper insertion into the inner membrane and disrupting the formation of the secretion channel .

  • Polar localization defects: VirB3 normally localizes to a cell pole, and mutations affecting this localization can impair T4SS assembly even if the protein remains stable .

The precise molecular mechanisms by which VirB3 contributes to T4SS assembly remain under investigation, but it appears to function as a critical structural component that enables the proper organization and stability of the secretion apparatus.

What is the evolutionary conservation of VirB3 across different bacterial species and type IV secretion systems?

VirB3 shows interesting patterns of evolutionary conservation across bacterial species and T4SS classes:

This evolutionary pattern suggests that while VirB3 plays a critical role in many T4SS variants, there may be functional redundancy or alternative mechanisms in systems where it is absent.

How do post-translational modifications and protein-protein interactions regulate VirB3 function?

The regulation of VirB3 function involves complex post-translational mechanisms and protein interactions:

  • Proteolytic regulation: Research suggests that bacteria use selective proteolysis as a mechanism to prevent assembly of unproductive T4SS precursor complexes. VirB3 from pTiA6NC requires VirB4, VirB7, and VirB8 for stabilization, suggesting that in the absence of these partners, VirB3 is degraded .

  • Multiprotein complex formation: Rather than binary interactions, evidence suggests that VirB3 functions within a multiprotein complex. The stabilization of VirB3 requires the simultaneous presence of multiple other VirB proteins, indicating cooperative assembly .

  • Membrane localization: The function of VirB3 depends on proper localization to the inner membrane. This localization appears to be regulated by interactions with other membrane components of the T4SS .

  • Polar targeting: VirB3 localizes to a cell pole, similar to other T4SS components. This polar localization is likely regulated by interaction with the bacterial cytoskeleton or specific membrane domains .

  • Integration with plant signaling: The fully assembled T4SS, including functional VirB3, responds to plant-derived signals such as phenolic compounds that induce virulence gene expression. This suggests integration with environmental sensing mechanisms .

Understanding these regulatory mechanisms could provide targets for inhibiting T4SS function as a strategy to control bacterial pathogenicity.

What are the current challenges in structural studies of VirB3 and the T4SS complex?

Structural studies of VirB3 and the complete T4SS face several significant challenges:

  • Membrane protein crystallization: As a membrane protein with two transmembrane domains, VirB3 is inherently difficult to crystallize for X-ray crystallography. Detergent selection, protein stability, and crystal packing are major hurdles .

  • Size and complexity of the T4SS: The complete T4SS is a large macromolecular complex spanning both bacterial membranes. Capturing the entire assembly in a functional state for structural studies is extremely challenging .

  • Dynamic assembly process: The T4SS assembly is dynamic, with components potentially rearranging during the translocation process. Static structural methods may not capture this dynamism .

  • Protein stability issues: VirB3 requires interactions with multiple partners (VirB4, VirB7, VirB8) for stability. Isolating VirB3 for structural studies may lead to protein degradation if these stabilizing interactions are disrupted .

  • Technical limitations in visualization: While electron microscopy has advanced significantly, resolving the detailed structure of membrane protein complexes at the atomic level remains challenging, particularly for smaller components like VirB3 .

Recent advances in cryo-electron microscopy and integrative structural biology approaches may help overcome some of these challenges, potentially leading to more detailed structural insights into VirB3's role within the T4SS.

How can systems biology approaches enhance our understanding of VirB3's role in bacterial pathogenicity?

Systems biology offers powerful approaches to understand VirB3's role within the broader context of bacterial pathogenicity:

  • Network modeling: Integrating protein-protein interaction data, genetic dependencies, and functional outcomes can help model how VirB3 fits within the T4SS network and broader virulence pathways .

  • Transcriptomic analysis: RNA-seq studies comparing wild-type and virB3-deficient strains under various conditions can reveal how VirB3 affects global gene expression patterns, potentially uncovering unexpected regulatory roles .

  • Comparative genomics: Analysis of virB3 conservation and variation across bacterial species and strains can provide insights into evolutionary adaptations and host-specificity determinants .

  • Host-pathogen interaction modeling: Integrating bacterial and plant (or human, in case of opportunistic infections) response data can help understand how VirB3-dependent processes influence the outcome of infections .

  • Multi-omics integration: Combining genomics, transcriptomics, proteomics, and metabolomics data can provide a comprehensive view of how VirB3 and the T4SS influence bacterial physiology and pathogenicity across different environmental conditions .

  • Evolutionary simulations: Computational models of plasmid evolution can help understand how virB3 and other T4SS components have been shaped by selective pressures and horizontal gene transfer events .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.